KEGG   Microlunatus phosphovorus: MLP_15330Help
Entry
MLP_15330         CDS       T01535                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose-5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mph  Microlunatus phosphovorus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mph00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1658727..1659989
Genome map
AA seq 420 aa AA seqDB search
MACKTVAVRDVVILGSTGSIGTQALEVIAAAPDRFQVVGLGAGGGQVELLARQALDFGVD
TVAVTRATVVQDLQLAFYAEASRRGWSSGKAKLPRILAGPDAATELAAAPCDVVLNGITG
SAGLRPTLAALQTGRILALANKESLVVGGRLVTSAARPDQIVAVDSEHSALAQALCGGTA
AEVDRLILTASGGPFRGRSREQMRDVTPEQALAHPTWAMGRVITTNSATLVNKGLELLEA
HLLYGVDLDRIDVVVHPQSVVHSMVQFVDGSTLAQCSPPDMKLPIALGLGWPERVPGAAR
PCDWSTATAWTFEPLDDEAFPAVELARRAGRVAGTAPAVYNAANEEAVEAFHAGTLPFLG
IVDVVAAVLAEHVGESVDDVRSNWSSDDELSLERVLAADAWARQRAVQVASAMAERESAR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcaagactgtcgcggtgcgcgacgtggtgattctgggcagcaccggctccatc
ggtacgcaggcgctggaggtgattgccgccgctccggaccggttccaggtggtcggcctg
ggcgccggcggaggacaggtcgaactgctggcgcggcaggccctcgacttcggcgtggac
acggtcgcggtcaccagggccaccgtcgtccaggatctccagctggcgttctatgccgag
gcgtcgcgacgcggctggtccagcggcaaggcgaagctgccgcggatcctggccggcccg
gatgccgccaccgagctcgcggcggcgccctgcgacgtggtgctgaacgggatcaccggc
tcggccggtctgcgtccgaccttggccgctctgcagaccggacgcatcctcgccctggcc
aacaaggagtcgttggtggtcggcgggcggctggtcacttccgcggcgagaccggatcag
atcgtcgccgtcgactccgaacactcggccctggcgcaggcgctgtgcggcggcaccgcc
gccgaggtcgaccggctgatcctgaccgccagcggtgggccgttccgcggccggagtcgc
gagcagatgcgcgacgtgacccccgagcaggcacttgcgcaccccacctgggcgatgggc
cgggtgatcaccaccaacagcgccaccctggtgaacaagggcctggagctgttggaggcg
cacctgctctatggcgtggaccttgaccggatcgacgtcgtcgtccatccccagtcggtg
gtgcactcgatggtccagttcgtcgacggatccaccttggcccagtgctcgccgccggac
atgaagctgccgatcgcgctcggtctgggctggccggagcgggtccccggtgccgcgcgg
ccgtgcgactggtcgaccgcgaccgcctggaccttcgagccgctggacgacgaggcgttc
cccgcggtcgagctggcccgccgagcaggacgcgtggcgggcaccgcccctgccgtctac
aacgctgccaacgaggaggcggtcgaggcattccacgccgggacactgcccttcctcggc
atcgtcgacgtggtggccgcggtgctcgccgagcatgtcggcgagtcggtggacgacgta
cgctcgaactggtcgtccgatgacgagctcagcctcgagcgcgtcctggcggccgatgcc
tgggcacggcagcgagccgtccaggtcgcgtccgcgatggcggagagggagagcgcacgc
tag

DBGET integrated database retrieval system