KEGG   Microlunatus phosphovorus: MLP_15750Help
Entry
MLP_15750         CDS       T01535                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mph  Microlunatus phosphovorus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MLP_15750 (speB)
Enzymes [BR:mph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     MLP_15750 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1705158..1706132
Genome map
AA seq 324 aa AA seqDB search
MTERGPQSGGAPIGPVDATRVPRYGGPATFARLPRIDEVSRADVAILGVPFDSGVSYRPG
ARFGPGHIRAASKLLRPYNPAQDVFPFGAQQVADAGDIGVNPFDLDQAIADVDAGVTKVR
ADGATVLTLGGDHTIALPILRSLARDHGPVAVLHFDAHLDTWDTYFGAPYTHGTPFRRAS
EEGLLDLERCLHMGIRGPLYAKSDLEDDTRLGFSIIRSDDYETDGVSGAVERMRKRLDGG
PVYVSIDIDVLDPAHAPGTGTPEAGGLTSRELLNTLRGLTGLNVVGADIVEVSPPYDHAE
ITGIAASHVAYELLSVLAANSASA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcgcggtccgcagagcgggggcgcgccgatcggaccggtcgacgcgacccgg
gtgccccgctacggaggtccggcgaccttcgcccgactgccgcggatcgatgaggtgtcc
cgcgccgatgtggccattctcggagtcccgttcgactccggggtcagctaccggccgggt
gcccggttcggtcccggccacatccgggccgcctccaagctgttgcggccctacaacccg
gcccaggacgtgttcccgttcggcgcccagcaggtcgccgatgccggcgacatcggggtc
aatcccttcgacctcgaccaggcgatcgctgacgtcgacgccggggtgacgaaggtccgg
gctgacggtgcgacggtgctgaccctgggcggtgatcacacgatcgcgttgccgatcctg
cggtcgctggcccgcgatcacggcccggtcgcggtgttgcacttcgacgcgcatctggac
acctgggacacctacttcggggctccctatacccacgggaccccgttccggcgcgccagc
gaagagggcctgctggacctggaacgctgtctgcacatgggaatccgcggtccgctgtac
gccaagagtgatctcgaggacgacactcgcctcggcttctcgatcatccgctccgacgac
tacgagaccgacggggtctccggagcggtcgagcggatgcgcaagcgactggacggcgga
ccggtctatgtctcgatcgacatcgacgtgctggacccggcgcatgcgccgggcaccggc
acccccgaggccggtggcctgaccagccgcgagctgttgaacacgttgcgcggtctcacc
gggctgaacgtcgtcggggccgacatcgtcgaggtgtcaccgccgtacgaccatgctgag
atcaccggtatcgcggcctctcacgtggcctacgagctgctctcggtgctggccgccaac
tccgcgtccgcatag

DBGET integrated database retrieval system