KEGG   Microlunatus phosphovorus: MLP_16130Help
Entry
MLP_16130         CDS       T01535                                 

Gene name
rnc
Definition
ribonuclease III (EC:3.1.26.3)
Orthology
K03685  
ribonuclease III [EC:3.1.26.3]
Organism
mph  Microlunatus phosphovorus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1742583..1743284
Genome map
AA seq 233 aa AA seqDB search
MLSPAAPIAEPIADVLARLQLTVADELFDRALTHRSYAYEQGGIPTNERLEFLGDSVLGV
IVTEHLFISYPDLSEGQLAKLRAAVVNSRALADVARGLQLGGRIHLGRGEDSTGGREKSS
ILADTMEAVIGAVFLEHGITGAGVLVHHLFDALMADAATRGAGLDWKTSLQEVASLGGHG
VPVYVVSESGPDHAKTFSATVVVGDQTYGPGTGRNKKEAEQKAAAQAFAAIGA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtctccggcggctccaattgccgagccgatcgctgacgtgctggctcgactgcag
ctcacggtcgccgacgagttgttcgatcgcgccctgacccaccgctcatacgcgtacgag
cagggcggaattccgacgaacgagcggctggagttcctcggtgactcggtgctcggggtg
atcgtgaccgagcatctgttcatttcctatcccgatctctccgaaggccagctcgccaag
ctgcgcgctgcggtggtcaactcgcgtgcgctcgccgatgtcgcccgtggcctgcagttg
ggcgggcggattcatctgggccggggcgaggacagcaccggcggccgggagaaatcctcg
atcctggccgacaccatggaagcggtgatcggcgcggtcttcctggagcacggcatcacc
ggcgccggcgtgctcgtccaccacctgttcgacgcgctgatggccgatgccgccacccgg
ggcgccggcctggactggaagacgagcctgcaggaggtcgcctctctcggtggtcacggc
gtgcctgtctatgtggtcagcgaatccgggcccgaccacgccaagaccttctccgccacc
gtggtggtcggcgaccagacatacggtcccggcaccggccggaacaagaaggaagccgag
cagaaggcggcagctcaggccttcgccgcgatcggtgcctga

DBGET integrated database retrieval system