KEGG   Microlunatus phosphovorus: MLP_17010Help
Entry
MLP_17010         CDS       T01535                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_17010
   01230 Biosynthesis of amino acids
    MLP_17010
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_17010
  Energy metabolism
   00680 Methane metabolism
    MLP_17010
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLP_17010
Enzymes [BR:mph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MLP_17010
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MLP_17010
  Exosomal proteins of melanoma cells
   MLP_17010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1830463..1831188
Genome map
AA seq 241 aa AA seqDB search
MATVLLVRHGRTAANSSGILAGRSPGVELDEVGRAQVGTLGERLAPVPLARLVSSPLQRC
RQTAHALLAGRAVPVPNSIESRLTECGYGDWTGRTLKELAKESLWQTVQQQPSAVRFPGG
EAMTEMAARAVGAVRAWDADVTAEHGENAVWVAVSHGDVIKAILADALGTHLDTFQRILV
NPASVSVIRYTAARPYVVTMNSTGADLAGMFPAGRSAADQTTDDAPVGGGLGAQEPTAGK
G
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccacggtcttgctggttcggcacggacggactgccgccaactcctcgggcattctc
gcgggccgcagcccgggcgtggagctggacgaggtcggtcgcgcgcaggtcggcacgttg
ggggagcggttggcgccggtgccactggcgaggctcgtcagctcacctttgcagcggtgc
cgccagacggcccacgccctgcttgcaggccgcgccgtgccggtgccgaacagcatcgag
tcccggctgaccgagtgcggctacggggactggaccggccgcaccctcaaggagctggcc
aaggagagtctctggcagacggtgcagcaacaaccgtcggcggtccgtttccccggtggc
gaggcgatgaccgagatggcggcccgcgccgtgggcgcggtccgtgcttgggatgccgac
gtcaccgccgagcacggtgagaatgcggtgtgggtcgcggtgtcccacggggacgtgatc
aaggcgatcctcgccgatgcgttgggcacccatctggacacgttccagcgcatcctggtc
aacccggcctcggtctcggtgatccgctacaccgccgcccgaccgtacgtggtgacgatg
aactccactggcgccgacctggccgggatgtttcctgccgggcggtctgctgcagatcag
acgaccgacgatgctccggtcggcggcggtctcggggcgcaggaaccgaccgccggcaag
ggatag

DBGET integrated database retrieval system