KEGG   Microlunatus phosphovorus: MLP_21680Help
Entry
MLP_21680         CDS       T01535                                 

Gene name
xfp
Definition
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase (EC:4.1.2.22 4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
mph  Microlunatus phosphovorus
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MLP_21680 (xfp)
Enzymes [BR:mph01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     MLP_21680 (xfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2309376..2311799
Genome map
AA seq 807 aa AA seqDB search
MSTTTYDPTTSGPTSAGVLQPMSEAELASIDAWWRANNYLTIGQIYLKSNPLLAEPLSAD
DIKPRLLGHWGTSPGLSFVYAHVNRLIRHTGQECIYLTGPGHGGPALVAAGYLEGSYTET
YPAISQDSAGLTRLFRQFSAPGGIPSHVSVTTPGSIHEGGELGYALVHAFGAVMDNPDLL
AVTIVGDGEAETGPLEGSWKGISFINPTRDGAVLPILHLNGAKIAGPTVLSRKPAAEVRS
LLEGHGYEVLEVSGDDLPGMHHRFAEALATAYEKIRTIQAEARATGRIEHRPHWPMIILR
SPKGWTGPEQVDGVKVTGTWRSHQVPLSGVRENPEHLQLLEQWLKSYRPEELFDDNGRPT
ELVLAANPQGELRMSASPHANGGLLTRDLDLPDFRDFAVTLTNPGTAVESTRRMGEMTAE
IYRRNPDSFRLFCPDETNSNRLGAVFGVSDRAFMERVTPEDVKLSADGRVMEVLSEHNCH
GWLEGYNLTGRHGLFATYEAFAMVSASQTIQHGKWLEEANHLSWRAKVPSLNILLTSTTW
RNDHNGFSHQGPGLIQNVITQRGDVSRVYLPPDANSLLSVWDHCLRSKSYINLIVIDKQP
QQQWLTIDEAVAHCAEGAGIWTWAGNDDGSRDPDIVLACAGDVVTMETVAAAELLQEKLP
DLKVRVVNVVDLMTLPRPQDHPHGMDNTFFRELFTDSVDVVFSFHGFPGAIHQLVHGRPD
ADRFHVRGFIEQGTTTTPFDMVVRNRASRYHLVIDAINNARRTPPGASAVKAWAQAQLDK
HQSYIIEHLEDMPEVREWTWQRTERTV
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaccacatatgaccccaccacctctgggcctacctcggcaggcgtcctgcag
ccgatgagcgaggccgaattggcgtcgatcgatgcctggtggcgggccaacaactacctc
accatcggccagatctatctcaagtcgaatccgctgctcgcggagccgttgagtgccgat
gacatcaagccacgcctgttgggccactggggcaccagccctggcctgtccttcgtgtac
gcccacgtcaaccggctgatccggcacaccggccaggagtgcatctacttgaccgggcca
ggccacggcggcccggcgctggtcgccgccggctacctggagggcagctataccgagacc
tacccggcgatctcccaggactctgccgggctgaccaggctgttccgtcagttctccgcc
ccgggtggcatcccgagccacgtctcagtgaccactcccggctcgatccacgaaggtggt
gagctcggctacgccctggtgcacgccttcggtgcggtgatggacaaccccgacctgctg
gcagtcaccatcgtcggcgacggcgaggccgagaccgggccgttggagggctcatggaag
ggcatctccttcatcaacccgacccgggacggcgcggtgctgccgatcctgcacctcaac
ggcgccaagatcgccggcccgaccgtgctgagccgcaagcccgcggccgaggtccgtagc
ctgctggagggccacggctacgaggtgctcgaggtcagcggcgacgatctgcccggcatg
caccaccggttcgccgaggccctggcgaccgcgtacgagaagatcaggaccattcaggct
gaggcgcgtgcgaccggccggatcgagcaccggccgcactggccgatgatcatcctgcgc
tcgcccaagggctggaccggtcccgagcaggtcgacggggtgaaggtgaccggcacctgg
cgcagtcaccaggtcccgctgtccggagtccgggagaacccggagcatctccagctgctg
gagcagtggctgaagtcctatcggccggaggaactgttcgacgacaacggccgcccgacc
gagctggtgctggccgcgaatccccagggtgagttgcggatgagcgcgagcccgcatgcc
aacggtggtctgctgactcgagatctcgacctcccggacttccgggacttcgcggtgacg
ctgaccaacccgggcacggcggtcgagtcgacccgccggatgggggagatgaccgcggag
atctatcgtcgcaatccggacagcttccggctgttctgccccgacgagaccaactccaac
cggctgggcgcggtgttcggagtctctgatcgggccttcatggagcgcgtcacccccgag
gatgtcaagctctccgccgacggccgggtgatggaggtgctcagcgagcacaactgccat
ggctggctggagggctacaacctcaccggccggcacgggctgttcgccacctatgaggca
ttcgcgatggtgagcgcctcccagaccatccagcacggcaagtggctggaggaggccaat
cacctctcgtggcgggcgaaagtaccgagtctcaacatcctgctcacctcgaccacctgg
cgcaacgaccacaacggcttctcccaccagggtccgggactgatccagaacgtcatcacc
cagcggggtgacgtgtcccgggtctatctgccgccggacgccaactcgttgctgtcggtc
tgggatcactgcctgcgctcgaagagctacatcaacctgatcgtcatcgacaagcagccg
cagcagcagtggctgaccatcgacgaggccgtcgcacactgcgctgagggtgccggcatc
tggacctgggccggcaacgacgacggcagccgggatccggacatcgtgctggcctgtgcc
ggtgacgtggtcacgatggagacggtcgccgccgccgagctgctccaggagaagctgccg
gatctgaaggtccgggtcgtcaacgtggtcgatctaatgacgttgccgcggccgcaggac
catccgcacggcatggacaacaccttcttccgggagctgttcaccgacagcgtggacgtg
gtgttctccttccacggcttccccggggccattcaccagctggtgcacgggcgtcccgac
gccgatcggttccacgtccgcgggttcatcgagcagggcaccacgacgacaccgttcgac
atggtggtgcgcaaccgggcgtcgcgctatcacctggtgatcgatgcgatcaacaatgcc
aggcggacgccgccgggcgcgagcgcggtgaaggcttgggcgcaggcacagctggacaag
caccagagctacatcatcgagcatctggaagacatgcccgaggtccgcgagtggacctgg
cagcgaacagaaaggacggtctga

DBGET integrated database retrieval system