KEGG   Microlunatus phosphovorus: MLP_22040Help
Entry
MLP_22040         CDS       T01535                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_22040
   01230 Biosynthesis of amino acids
    MLP_22040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_22040
  Energy metabolism
   00680 Methane metabolism
    MLP_22040
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLP_22040
Enzymes [BR:mph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MLP_22040
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MLP_22040
  Exosomal proteins of melanoma cells
   MLP_22040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2353445..2354131
Genome map
AA seq 228 aa AA seqDB search
MRFVLIRHGQSINNLLWAETGDSIGRHHDPVLSPLGHQQAQLLGDVLADGVLPWRITQLH
SSLMTRAVQTAAPLADALDLPLIGHPEAYETGGLYVEEVAGVRIPHRGATAADLQLLSRR
LILPDSARADGWFPGPYEDGDALIMDRARRVVADLRARHDDDDVVALVMHGAFFQYLFRA
LLGIDTMSGWIVKHNTAMTLVADESVGGITIAHRIDWTPHLTDDQLTL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgttctcatccggcacggacagtcgatcaacaacctgctgtgggccgagacc
ggcgactcgatcggccgtcaccacgaccccgtgctctcgccgttggggcaccagcaggcc
cagttgctcggtgatgttctggccgacggagtgctgccatggcggatcacacagctgcac
tccagtctgatgacccgtgcggtgcagaccgcagcaccactggccgacgcactcgatcta
ccgctgatcgggcatccggaggcgtacgagaccggcggtctgtacgtggaggaggtcgcc
ggcgtaaggatcccgcatcggggagcgacggccgccgacctgcagttgctgtcgcggcga
ctgatcctgccggacagcgcgcgtgccgacggctggttccccggcccgtacgaggacggc
gatgcgctgatcatggaccgggcgcgccgggtggtcgccgatctgcgggctcggcacgac
gacgatgacgtggtggcgctggtgatgcacggcgccttcttccagtacctgttccgagcc
ttgctcggcatcgacaccatgagcggttggatcgtcaagcacaacacggccatgacgctg
gtcgccgacgagtctgtcggcggcatcaccatcgcccaccggatcgactggacgccgcac
ctcaccgacgaccaactgacgctctag

DBGET integrated database retrieval system