KEGG   Microlunatus phosphovorus: MLP_22140Help
Entry
MLP_22140         CDS       T01535                                 

Definition
uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
mph  Microlunatus phosphovorus
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mph00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2362297..2363214
Genome map
AA seq 305 aa AA seqDB search
MSDVTVSLGANKYGKAECRLVKITRDTARHEIEDLNVTSQLRGARLVDSYLTGDNSLVVA
TDTQKNTVYAFAREHGVGSPEELLLRLGDHFVSSFDWIEGGLWQAEQYSWDRILLDGLEH
DHSFVRKGQATRLATVQKVDGETHVTAGLKDLVVLKSTGSEFRGFPRDRYTTLIETDDRI
LATSVTGRWRYLPEAVEAGIDFNALYAGVSEVFLATFASVHSLALQQTQWEMGKAAIEAF
PEIAEVKFAMPNKHHFLVDLAPYGLENPNEVFYAADRPYGLIEGTIVRDGVAAAPQAWTD
VPTFV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgtcaccgtcagtttgggcgccaacaagtacggcaaggccgaatgccgcctg
gtcaagatcacccgtgacacagcgcgacatgagatcgaggatctcaacgtcaccagccaa
ttgcgtggcgcccggctcgttgattcctatctgaccggggacaattcgctggttgtcgcc
accgacacccagaagaacacggtctacgccttcgcgcgggagcacggtgtcggctctcct
gaagagctcttgctgaggctcggcgaccatttcgtctcgtccttcgactggatcgaggga
ggtctgtggcaggccgagcagtacagctgggaccgcatcctgctggatggtctcgaacac
gaccactcttttgtccgcaaaggtcaggccacgcggctcgccaccgtgcagaaggtggac
ggggaaacccatgtcacggccggtctcaaggacctggtggtgctcaagtccaccggtagc
gagtttcgcgggtttccccgcgaccgctacaccactttgatcgagaccgacgaccgcatc
ctggccacctcggtcaccggtcgttggcgctatctgcccgaggccgtcgaggccggaatt
gatttcaacgcgctctatgccggagtcagcgaggtcttccttgccaccttcgcaagcgtt
cactccctggcgctgcagcaaacccagtgggagatgggcaaggctgccatcgaggctttc
ccagagatcgccgaagtgaagttcgcgatgcccaacaagcaccatttcctggtggacctg
gctccctatgggctggagaacccgaacgaagtgttctatgccgccgaccgcccgtacggc
ctgatcgagggaacgatcgtgcgcgacggcgtcgccgctgcaccgcaggcctggaccgac
gtccccacttttgtctga

DBGET integrated database retrieval system