KEGG   Microlunatus phosphovorus: MLP_22140Help
Entry
MLP_22140         CDS       T01535                                 

Definition
uricase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
mph  Microlunatus phosphovorus
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MLP_22140
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    MLP_22140
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     MLP_22140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2362297..2363214
Genome map
AA seq 305 aa AA seqDB search
MSDVTVSLGANKYGKAECRLVKITRDTARHEIEDLNVTSQLRGARLVDSYLTGDNSLVVA
TDTQKNTVYAFAREHGVGSPEELLLRLGDHFVSSFDWIEGGLWQAEQYSWDRILLDGLEH
DHSFVRKGQATRLATVQKVDGETHVTAGLKDLVVLKSTGSEFRGFPRDRYTTLIETDDRI
LATSVTGRWRYLPEAVEAGIDFNALYAGVSEVFLATFASVHSLALQQTQWEMGKAAIEAF
PEIAEVKFAMPNKHHFLVDLAPYGLENPNEVFYAADRPYGLIEGTIVRDGVAAAPQAWTD
VPTFV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgtcaccgtcagtttgggcgccaacaagtacggcaaggccgaatgccgcctg
gtcaagatcacccgtgacacagcgcgacatgagatcgaggatctcaacgtcaccagccaa
ttgcgtggcgcccggctcgttgattcctatctgaccggggacaattcgctggttgtcgcc
accgacacccagaagaacacggtctacgccttcgcgcgggagcacggtgtcggctctcct
gaagagctcttgctgaggctcggcgaccatttcgtctcgtccttcgactggatcgaggga
ggtctgtggcaggccgagcagtacagctgggaccgcatcctgctggatggtctcgaacac
gaccactcttttgtccgcaaaggtcaggccacgcggctcgccaccgtgcagaaggtggac
ggggaaacccatgtcacggccggtctcaaggacctggtggtgctcaagtccaccggtagc
gagtttcgcgggtttccccgcgaccgctacaccactttgatcgagaccgacgaccgcatc
ctggccacctcggtcaccggtcgttggcgctatctgcccgaggccgtcgaggccggaatt
gatttcaacgcgctctatgccggagtcagcgaggtcttccttgccaccttcgcaagcgtt
cactccctggcgctgcagcaaacccagtgggagatgggcaaggctgccatcgaggctttc
ccagagatcgccgaagtgaagttcgcgatgcccaacaagcaccatttcctggtggacctg
gctccctatgggctggagaacccgaacgaagtgttctatgccgccgaccgcccgtacggc
ctgatcgagggaacgatcgtgcgcgacggcgtcgccgctgcaccgcaggcctggaccgac
gtccccacttttgtctga

DBGET integrated database retrieval system