KEGG   Microlunatus phosphovorus: MLP_22430Help
Entry
MLP_22430         CDS       T01535                                 

Definition
(GenBank) hypothetical protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00860  Porphyrin and chlorophyll metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MLP_22430
Enzymes [BR:mph01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MLP_22430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 Sigma54_activat AAA_3 AAA_16 AAA_PrkA AAA_22 NACHT ABC_tran DUF2939 RuvB_N
Motif
Other DBs
NCBI-ProteinID: BAK35257
UniProt: F5XEP1
Position
2398511..2399911
Genome map
AA seq 466 aa AA seqDB search
MTPTTLGQLATLGQLRASGYQPKSVAEELRSNLLTRLRSGETAFPGIVGFDDTVLPELET
ALLAGHDLVLLGERGQGKTRLMRTLIQLLDEWSPEVADCEIHDDPYAPVCVRCRALAAEF
GEELPIAWRHRDDRYTEKLATPDTSVGDLIGDVDPVKVAQGRTLGDPETVHYGLVPRTNR
GVFGLNELPDLAERIQVALFNVLEERDIQVRGYSLRLPLDVFLVATANPEDYTNRGRIIT
PLKDRFGAEIRTHYLSELHDEVSLIRQEAELVADVGDHLLEVLARFTASLRTSASIDQRS
GVSARFTIAAAEAVAGSALRRAGRTNDPEAVARVGDLPAVLPTLLGKVEFEMGEEGRERE
VLEHLLRMAIAATFRDRLGGLDLSGFTAVFAEGAIVETGDLVPAAELLSQLGTVTGLAKV
LDRLGYADSAGRGQVAAAAEFVLEGLHLTRRIDKDAVGGRTIYGAR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccaccaccctcggccaactcgccaccctcggccaacttcgtgccagcggctac
cagcccaagtccgttgccgaggaactgcgttcgaatctgctgaccagactccgcagcggc
gagacggccttccccgggatcgtcggtttcgacgacaccgtgctgccggagttggagacc
gcgctgttggcgggtcatgatctcgtcctgctcggcgagcgcggccaggggaagacccgg
ctgatgcggaccttgatccagctgctggacgagtggagtcccgaggtcgccgattgtgag
atccacgacgacccgtacgcgccggtctgcgtccggtgccgggcactggccgccgagttc
ggtgaggaactgccgatcgcctggcggcatcgggatgaccgttacaccgagaagctcgct
acgcctgacaccagcgtcggcgacctgatcggcgacgtggacccggtcaaggtcgctcag
ggccgtaccctcggcgacccggagaccgtgcactacggactggtgccgcggaccaaccgt
ggcgtcttcgggctgaacgagctgcccgacctggccgagcgcatccaggtcgcgctgttc
aacgtgctggaagagcgagacatccaggtccgcggctattcgctgcggctgcccttggac
gtgttcctggtcgccaccgccaacccggaggactacaccaaccggggccggatcatcact
ccgctgaaggaccggttcggcgccgagatccgcactcattatctgtccgaactgcacgac
gaggtctcgttgatccggcaggaggccgagctggtcgccgacgtcggcgaccacctgctc
gaggtgctggctcggtttaccgcgagtctgcgtacatccgcctcgatcgaccagcgctcg
ggggtctcggcacgcttcaccatcgccgcagccgaagccgtcgccggttcggcgctgcgg
cgtgccggccggacgaacgacccggaagccgtcgcccgggtcggcgacctgccggcggtg
ctgcccaccctgctcggcaaggtcgagttcgagatgggagaggaaggccgcgaacgcgag
gtgctggagcacctgctccgaatggcaatcgcggccaccttccgcgatcggctcggcggg
ctcgatctgtcgggtttcacggccgtgttcgccgagggcgcgatcgtcgagaccggcgac
ctggtgccggcggcggagctgttgtctcagctcggcacggtcaccgggctggccaaggtg
ctcgatcgacttgggtacgccgactcggccggccgcggccaggtcgccgctgcggccgag
ttcgtgctcgagggcctgcacctcacccgccggatcgacaaggacgcggtcggtggtcgg
acgatctacggggctcgctga

DBGET integrated database retrieval system