KEGG   Microlunatus phosphovorus: MLP_22910Help
Entry
MLP_22910         CDS       T01535                                 

Definition
alcohol dehydrogenase (EC:1.1.1.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MLP_22910
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_22910
  Lipid metabolism
   00071 Fatty acid degradation
    MLP_22910
  Amino acid metabolism
   00350 Tyrosine metabolism
    MLP_22910
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MLP_22910
   00626 Naphthalene degradation
    MLP_22910
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MLP_22910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2460336..2461343)
Genome map
AA seq 335 aa AA seqDB search
MAFMDAWVVDQPGPIDNHPLLRLQRDDPVPGPGQVRVKISCCGVCRTDLHLAEGDLPPKR
PRVTPGHEVVGVVDAVGADARRFMIGDRVGVAWLGKTDGSCRFCRQGRENLCLHPTFTGW
DVDGGYAAACLVDESFAYRLPDGLADETAAPLLCAGIIGYRALQRAAVPDGGRLGIYGFG
GSAHLTAQIALAQGLRVHVLTRGEPNQALARELGVDSVGGPSDPPPEPLDGAILFAPAGE
LVPVALRALDRGGTLAMAGIWSSDIPTLNYDETLFQERQLVSVTANTRDDGETFLALAAR
LGVRATTVPYPMADANRALIDLKHGRFGGAAVLHV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcatggacgcctgggtggtcgaccaacctggaccgatcgataatcatccgctg
ttgcgtctccagcgcgacgatccggtgccggggcctgggcaggtccgggtcaagatcagc
tgctgcggcgtctgtcggacggatctgcacctggccgaaggggatctgccgccgaagcgt
ccgcgagtgacacctggacatgaggtcgtcggagtggtcgacgcggtcggcgccgatgct
cggcggttcatgatcggggatcgggtcggcgtggcctggctcggcaagaccgacggcagc
tgccgtttctgccgccagggtcgcgagaacctgtgcctgcacccgaccttcaccggctgg
gacgtcgacggcgggtacgccgccgcctgtctggtcgacgagtctttcgcctaccggctg
cccgacgggctggctgacgagacggccgctcccctgttgtgtgccggcatcatcggttat
cgagcgctgcaacgggcggctgtccccgacggtggtcggctcggcatctacggtttcggc
ggcagtgcccatctgacggcgcagatcgctctggcccaagggctgcgggtgcatgtgctg
acccgcggcgagcccaaccaggcattggcccgcgagctcggggtcgactccgtgggcggg
ccgagcgacccgccgccggagcctctcgacggcgccatcctgttcgcgccggccggcgag
ctggtcccggtcgcgttgcgggctctcgatcgtggcggcacgctcgccatggccgggatc
tggtcctccgacatcccgacgctgaactacgacgagaccctcttccaggagcggcagctg
gtcagcgtcaccgcgaacacccgcgacgacggcgagaccttcctggcgttggcggctcgc
ctcggtgtccgggcgaccaccgtcccgtacccgatggccgacgccaatcgggctctgatc
gatctcaagcacggccgattcggcggtgccgccgtactgcacgtctga

DBGET integrated database retrieval system