KEGG   Microlunatus phosphovorus: MLP_26610Help
Entry
MLP_26610         CDS       T01535                                 

Gene name
ppgK
Definition
polyphosphate-dependent glucokinase (EC:2.7.1.63)
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_26610 (ppgK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_26610 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    MLP_26610 (ppgK)
Enzymes [BR:mph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     MLP_26610 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2867903..2868664
Genome map
AA seq 253 aa AA seqDB search
MNETANIALGIDIGGTGIKGALVDLETGALVSDRFRLDTPRPALPAAVADTVVAVAAHFD
FAGPVGVAFPGVVLDGVVHTAANLHPDWIGASLAELVGSRLSGPSVFLNDADAAGLAEAR
FGAAKGVSGVVLLVTLGTGIGTAMISDGQLVPNSEFGHLELDGLDAETYAAASARKRNNH
TWEEWAGHAEHYLKYLEGLVWPKLFVLGGGITKNPELWLHYLKPRTPIVLATNINNAGII
GAAAAAAQTQQAG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgagactgcgaatattgcgctgggcatcgatatcggtggcaccggcatcaaggga
gccttggtcgatctcgagaccggagcgttggtcagcgaccggttccggcttgacaccccg
cgtccggcgctgccggccgcggttgccgacaccgtcgtagccgtcgcggcgcacttcgac
ttcgctggtccggtcggcgtggcgtttcccggtgtcgtcctcgacggcgtcgtgcacacg
gcggccaacctgcatccggattggatcggtgcctcactcgcggagctggtcggatcccga
ctgtcggggccgagcgtcttcctcaacgacgccgatgcggccggcctggccgaggcgcgg
ttcggcgcggcaaagggtgtctcaggtgtggtgctgctggtcactctcggcactggtatc
ggcaccgcgatgatcagcgacggccaactggtgccgaactccgagttcggccatctcgag
ctcgacggactcgacgccgagacgtacgcggcagcctccgcccgcaagcgcaacaaccac
acctgggaggaatgggccggccacgcggagcactacttgaagtatctcgaggggctggtc
tggccgaagctgttcgtgctcggcggcgggatcaccaagaacccagaactctggctgcac
tatctcaagccacgcacgccgatcgtgctcgccaccaacatcaacaacgccggcatcatc
ggtgccgccgctgcggccgctcagacccagcaagccggctga

DBGET integrated database retrieval system