KEGG   Microlunatus phosphovorus: MLP_27720Help
Entry
MLP_27720         CDS       T01535                                 

Definition
hypothetical protein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mph  Microlunatus phosphovorus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MLP_27720
  Lipid metabolism
   00561 Glycerolipid metabolism
    MLP_27720
   00600 Sphingolipid metabolism
    MLP_27720
Enzymes [BR:mph01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     MLP_27720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2989421..2991583)
Genome map
AA seq 720 aa AA seqDB search
MVLYLLAGWQGCVQLGSAISAIGSVIMERIRWGNGLIDLIVGIDADRPVTIDSLDVAGHE
RTTPARQPLVELLVLGQGRMLTNTRFTSTAVGDRLRYLGHRTETGDIAETLIIDQRDEVT
GLQVSTTLTAYAGVAGFQTTTTVHNTSQSVHLIQLLSSLALGCVLDDGERLDDLVLHSAR
NSWCAESRWTQTRLRADEGLGRIGRPDWDIESRSSVAAVSTSTWSTGQQLPTAVIDNLAT
GRAIGWQIEHNGAWCWEVDSRWIGLDEVAVILSGPDDLDHQWVLRLAPDDRFTTVPASIT
VSRAGWQGAVAALTEHRRAIRRPLVRPDLPVIFNDYMNALMGDPTTEKLLPLIDAAARTG
AEYFCIDAGWYDDGGNWWPSVGDWQPSTVRFPDGGLQRVLDHIRSRGMLPGLWVEPEVIG
VHSPAANRLPDEAFLQRYGVRIVEHDRYFLDLRHPAARAHLDEVIDRLVEGYGVRFFKLD
YNVTPGAGTDRDAFSVGDGLLQQNRAQLDWLRGVRDRHPEVVIENCSSGAMRMDYALLSL
LELQSTSDQMDPALYVPIAAAAPASVTPEQAGNWAYPQPGMTPEEIAFCMITGLAGRVYL
SGHLNRMSEAELGLVREGVQAYEGLRVDLGQAVPFWPVGLPTSQDPVVMLGLRAPHASYL
YVWFTQPGGHDPVTLDLGPKAPISTVYPASLPDWSLTWEADRLTIQPHGVGLTARVFRIS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctatctgttggcggggtggcaagggtgtgtccagctgggttcggcgatctcg
gcgataggttcggtgatcatggaacgcatccgctggggcaacggcttgatcgatctcatc
gtcggcatcgatgcggaccgcccggtgaccatcgacagcctcgatgtcgccggccacgag
cgcacgacgccggcgcggcagccgctggtcgagttgctggtgctgggtcagggacggatg
ctgaccaatacccggttcaccagcaccgccgtgggtgaccggctgcgctacctcggccat
cgaaccgagaccggcgacatcgccgagaccttgatcatcgaccagcgcgacgaggtcacc
gggctgcaggtcagcaccacgttgaccgcgtacgccggcgtggcgggctttcagaccaca
accacggtccacaacacctcccaatccgtccacctgatccagctgctcagctcgctggcg
ctcggttgcgtgctcgacgacggcgagcgactggatgacctggtgctgcattcggctcgg
aacagctggtgtgccgagagccggtggacccagacccggctccgcgccgacgagggcctg
ggccggatcggccggccggactgggacatcgagtcacgcagctcggttgccgcggtcagc
acctcgacctggtcgacgggtcagcagttgccgacggccgtgatcgacaatctggccacc
ggacgcgcgatcggctggcagatcgagcacaacggcgcctggtgctgggaagtcgacagc
cgctggatcggactcgacgaggtcgcggtgatcctctccggacccgatgatctcgatcat
caatgggtgctgcgactcgctccggatgatcggttcaccaccgtgccggcctcgatcacg
gtctccagggccggttggcagggcgccgtagcagccttgaccgagcaccgtcgcgcgatc
cgcagaccgctggtccggcccgacctgccggtgatcttcaacgactacatgaatgccttg
atgggtgatccgaccaccgagaagctgctaccgctgatcgacgccgcagcccggaccggc
gcggagtacttctgcatcgacgccggctggtatgacgacggcggcaactggtggccgagt
gtgggggactggcagccctcgaccgtgcgcttcccggacggcggcctgcagcgcgtactc
gatcacatccgcagccgaggcatgctgccgggcctgtgggtggagcccgaggtgatcggc
gtgcacagtcccgccgcgaaccggttgccggacgaggcattcctccagcggtacggggtc
aggatcgtcgagcacgaccgctacttcctggatctccgccatccggcggcccgcgcccac
ctggatgaggtcattgaccgtctggtcgagggttatggtgtccgattcttcaagctcgac
tacaacgtgactcccggtgccggcaccgaccgggacgccttcagcgtcggcgacggactg
ctgcagcagaatcgggcccagctggactggctgcgtggggtacgcgaccgccatcccgag
gtggtgatcgagaactgctcgtccggtgcgatgcggatggactatgcgctgctgtcgctg
ctcgagctgcagtcgacctcggatcagatggatccggcgctgtacgtgccgatcgccgcg
gcggcgccggcatcggtcacaccggagcaggccggcaactgggcctatccccagcccggt
atgacgccggaggagatcgccttctgcatgatcaccggactggccggacgggtctatctg
tccggccacctgaaccggatgagtgaggcggagctcggactggtgcgggagggcgtgcag
gcgtacgagggactgcgggtcgacctcggacaggcggtgccgttctggccggtggggctg
ccgaccagccaggatcccgtcgtgatgctcgggctgcgggcaccccatgccagctatctg
tacgtctggttcacccagccgggcgggcacgatccggtgacgctcgacctcggaccgaag
gccccgatctcgacggtctacccggcttcgctgccggactggtcgctgacctgggaggcg
gaccggttgacgatccagccgcacggcgttggactgaccgcgcgggtgttccggatcagc
tga

DBGET integrated database retrieval system