KEGG   Microlunatus phosphovorus: MLP_27950Help
Entry
MLP_27950         CDS       T01535                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00790  Folate biosynthesis
mph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MLP_27950 (folE)
Enzymes [BR:mph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MLP_27950 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: BAK35809
UniProt: F5XIE0
Position
3011998..3012639
Genome map
AA seq 213 aa AA seqDB search
MSRNGRSPGRAPGLLERNGFRPVVTNNRPAVDLAAAEQAAGLLLNALGLDLADENLAETP
RRMAHALIEMTNGPNFELTTFPNDEGYDELVLVQNIAMQSVCEHHMLPFVGVAHVGYLPG
SRILGLSKFARMVELHARRPQTQERLTKRIADHLQAELDPKGVGVVIEAEHTCMSLRGAR
NPRARTTTSAMFGRLRDEPRSRAEFLALTRSQR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcaacggcaggtctcccgggcgcgcaccgggcctgctcgagaggaatggcttc
cgtcccgtggtcaccaacaaccgtcccgcagtcgatctcgcagccgccgagcaagcagcc
gggctgctgctgaatgcgctggggttggatctggccgatgagaatctcgccgagacgcca
cgtcggatggcacacgctctgatcgagatgaccaacggcccgaacttcgagctcaccacc
ttccccaacgacgagggttacgacgaactggtcctggtccagaacatcgccatgcagtcg
gtctgcgagcatcacatgctccccttcgtcggagtcgctcacgtcggctaccttcccggt
tcgcgcatcctcggtctctcgaagttcgctcgcatggtcgagctgcacgcccgccgcccc
cagacccaggaacgactgaccaagcgcatcgccgaccacctccaagccgagctggatccg
aagggtgtcggcgtggtcatcgaggccgagcacacctgcatgagcctgcgcggggcccgt
aacccccgtgcccgcaccaccacctccgcgatgttcggcagactgcgcgacgagcctcgt
agccgcgccgagttcctcgccctcaccaggagtcaacgatga

DBGET integrated database retrieval system