KEGG   Microlunatus phosphovorus: MLP_28930Help
Entry
MLP_28930         CDS       T01535                                 

Definition
transcriptional regulator
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mph  Microlunatus phosphovorus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MLP_28930
Enzymes [BR:mph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MLP_28930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3118886..3119989
Genome map
AA seq 367 aa AA seqDB search
MTFPPLTGFRIGVTSDRRSDDLIAALERRGATVMHAPSLKIAPNDEDTALAEETQAVIES
RPEVVLVTTGYGMRRWFEVADAAGLGAELTDALESAKILARGPKSVGEVRAAGLEELAVS
ANDTTAALIDAVEQHSLTGLRTVIQLHAYTDRAQLARLRGLSARLWTVTPYRWVQPAGSD
RLQKLIDAACDRQLDAITFTSAPGAEATLAAAKSMGRLGELIAALNDDVLAATVGPVSAG
PLRHAGAQVLTPDRYRLGALIRLVTEELGERRVIRWRTDDVELELRGKVVVVAGKAVVLS
RNSLALFKLLAHDGALVSRQELLRSLPDGADDHALEVAMSRLRQALGVPGLIATIVKRGY
RLNAVRL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacctttcccccgctcaccggcttccggatcggcgtcacctcggaccgccgctccgac
gacctgatcgctgccctggagcgacgcggtgcaaccgtcatgcacgccccgtcgctcaag
atcgccccgaatgacgaggacaccgcactcgccgaggagacccaggcggtgatcgagtcc
cgacccgaggtggtacttgtcacgaccggatacggcatgcggcgctggttcgaggtcgct
gacgcagccggactgggagccgagctcaccgatgcgctcgagtcggccaagatcttggcg
cgcggcccgaagtccgtcggcgaagtccgtgcggctggcctggaggagctggcagtcagt
gccaacgacaccaccgcggcactgatcgacgcggtcgagcagcactccttgaccgggcta
cgcacggtgatccagctgcatgcctacaccgaccgagcccagttggcccgactccgcggc
ctgagcgctcggctgtggacggtcaccccgtaccgctgggtgcaacccgccggctccgac
cggctgcagaagctgatcgacgccgcgtgcgatcggcagttggacgcgatcaccttcacc
agcgctcccggggccgaggcgacgctggccgccgccaagtcgatgggccggctgggcgag
ctgatcgccgcactgaacgacgacgtcctagccgcgacggtcggcccggtgtccgccggc
ccactacgccacgccggtgcccaggtcctgaccccggatcgctatcggctcggcgccctg
atccggctggtcaccgaggaactgggcgaacgccgagtgatccgctggcgcaccgacgat
gtcgaactggaactgcgcggcaaggtggtcgtcgtggccggcaaggcagtggtgctcagc
cgcaactccttggccctgttcaaactgctggcgcacgacggcgcgctggtcagccgtcag
gaactgttgcgctcgctgcccgacggcgccgacgatcacgcgctcgaggtggcaatgagc
cggctccggcaggccctgggcgtgcctggcctgatcgccaccatcgtgaaacgcggctac
cggctgaacgccgtacgcctctag

DBGET integrated database retrieval system