KEGG   Microlunatus phosphovorus: MLP_29270Help
Entry
MLP_29270         CDS       T01535                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MLP_29270 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLP_29270 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MLP_29270 (trpA)
Enzymes [BR:mph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MLP_29270 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3156186..3157031)
Genome map
AA seq 281 aa AA seqDB search
MSFDLGRSGRLFADIKASGRGALVGFLHVGYPDVATSLAAVKALCGDGPNSDRPGVDLVE
VGLPYSDPMMDGVTIQRAGTRALARGVRTKDTFAAVEAVASTGTQAVVMTYWNLIEQYGP
DAFSRDLAAAGGSGVITPDLTPDEAEAWLAASDAHGLDRIFLLSPSSTDERIASTLAACR
GWVYATAVMGVTGARAQTSSAAPTLVERIRQADPGAMVGVGLGVSTGAQAREITRYADAA
IVGSALVATLLAAEAAGTPDDLSGLRAVVDDLAAGVRHHSG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcgacctcggccgctccggtcggctgttcgccgacatcaaggcgtccgggcgt
ggcgctttggtgggcttcctgcacgtgggctatccggacgtcgcgacctccctggcagcc
gtcaaagcgctctgcggcgatggcccgaacagcgaccgcccgggcgtcgacctggtcgag
gtcgggctgccgtacagcgatccgatgatggatggtgtcaccatccagcgcgccggcacc
cgggcgctggcccgtggggtccggaccaaggacaccttcgccgccgtcgaggcggtcgcc
tccaccggcacccaggccgtggtgatgacgtactggaatctgatcgagcagtacggtccc
gacgccttctcccgcgacctggctgccgccgggggatctggggtgatcacgccggacctg
actccggacgaggccgaggcctggctcgccgcctccgacgctcacggactcgaccggatc
ttcctgctctcaccgtcgtcgaccgacgagcggatcgccagcaccctcgccgcctgccgg
ggctgggtgtacgcgaccgccgtgatgggtgtcactggtgctcgggcgcagacctcctcg
gccgcgcccaccctggtggagcgcatccggcaggccgaccccggtgccatggtgggtgtc
ggactcggcgtgtccaccggcgcccaggcccgcgagatcacccgctacgcggatgcggcg
atcgtcggctcggcactggtcgccacgctgctcgccgccgaagccgccggcacgcccgac
gacctgtcgggtctgcgcgccgtggtcgacgacctcgcggccggtgtccgacaccactcc
ggatga

DBGET integrated database retrieval system