KEGG   Microlunatus phosphovorus: MLP_29280Help
Entry
MLP_29280         CDS       T01535                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MLP_29280 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLP_29280 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MLP_29280 (trpB)
Enzymes [BR:mph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MLP_29280 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3157028..3158290)
Genome map
AA seq 420 aa AA seqDB search
MVTQVLPDSTGHFDQFGGKFVPEALYAALRQLEAEFHAAQADPAFAAELTKLLTDYTGRP
SPITEAPRFAAHAVGESGVAPTIVLKREDLNHTGSHKINNVLGQALLTKRMGKTRVIAET
GAGQHGVATATAAALFGLECTVYMGRVDTERQALNVARMRLLGADVIAVESGSQTLKDAM
NDAMRDWVSTVDHTHYLIGTVAGPHPFPLLVREFQRIISTEARAQLLDRYDRLPDAVAAC
VGGGSNALGIFADFIPDAEVALYGFEAGGDGVETGKHAATISAGSVGVLHGMRTYVLQDD
DGQTKESHSISAGLDYPGVGPEHSWLAYTGRAHYEAITDAEAMEALALLTRTEGILPAIE
SAHALAGAIKLGKRLPLRADGTPPLILVSLSGRGDKDVDTAIRWFNIDTSGTPSTAGETR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggttacccaggtcctgcccgactcgaccggtcatttcgaccagttcggcggcaagttc
gtccccgaagcgctctacgccgccctgcgacagctggaggcggagttccatgccgcccag
gccgacccggccttcgccgcggagctgaccaagctgctcaccgactacaccggtcggccg
agccccatcaccgaggcgccccggttcgccgcgcacgccgtgggggagtcgggcgtcgcg
ccgaccatcgtgctgaaacgggaggatctcaaccacaccggttcccacaagatcaacaac
gtgctcgggcaggcgctgttgaccaagcggatgggcaagacccgggtgatcgccgagacc
ggtgccggtcagcacggggtcgcgaccgcgaccgccgcggcgctgttcgggctggagtgc
accgtctacatgggccgcgtcgacaccgagcggcaggcgctcaacgtcgcccggatgcgg
ctgctcggcgcggacgtgatcgcggtcgagtccggttcgcagacgctcaaggacgcgatg
aacgacgcgatgcgggactgggtctccaccgtcgaccacacccactatctgatcggcacc
gtcgccggcccgcacccgttcccgctgctggttcgggagttccagcggatcatctcgacc
gaggcccgtgcccagttgttggaccgctacgaccggctgccggacgcggtcgcggcctgc
gtcggcggcggctccaatgcgctcggcatcttcgccgacttcattcccgacgccgaggtc
gccctgtacggcttcgaggccggcggcgacggggtggagaccggcaagcatgccgccacc
atctcggccggctcggtcggcgtgctgcacgggatgcggacctacgtgttgcaggacgac
gacggccagaccaaggagtcgcactccatctcagctggtctggactatcccggggtcggc
cccgagcactcctggctggcctacaccggccgggcgcactacgaggcgatcaccgatgcc
gaggcgatggaagctctggcgctgctgacccgcactgaggggatcctgccggcgatcgag
tcggctcatgcgctggcgggggcgatcaagctgggcaagcggctgccgctccgggccgat
ggcacgccgcccctgatcctggtcagcctgtccggccgtggcgacaaagacgtggacacg
gcgatcaggtggttcaacatcgacacctccggcacgccgagcaccgcgggggagacccga
tga

DBGET integrated database retrieval system