KEGG   Microlunatus phosphovorus: MLP_29720Help
Entry
MLP_29720         CDS       T01535                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mph  Microlunatus phosphovorus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MLP_29720 (glgB)
Enzymes [BR:mph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MLP_29720 (glgB)
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MLP_29720 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3201564..3203819
Genome map
AA seq 751 aa AA seqDB search
MAFDPGGELTGWDLTGFHQGHDTEAWRRLGAHEITVTDSERGEISGTRFSVWAPNAQAVR
LAGDFNYWNDESSPMQLVPGSGVWSLFVEGVGTGTLYKFEVLGADGVWRLKADPFARFCE
APPHNASIVYESQYEWGDDQWLWFRGQKKQYEEPVSIYEVHLGSWRKGLTYVELARQLVE
YVSWQGYTHVELMPVAEHPFDGSWGYHVTGYYAPISRFGSPDEFRYLVDELHKAGIGVLV
DWVPGHFATDPWALQRFDGTALFEHEDPRLGWHPDWGSYIFNFGRNEVKSFLVSNAYYWL
DEFHIDGLRIDAVASMLYLDYSREAGQWVPNKFGGNENLEAVELLQTVNAHNYRRKPGIM
MVAEESTSWPGVTRAVDDGGLGFGFKWNMGWMNDSLRYYGRDPLYRQYHHHEMTFAMAYA
YSENFVLPISHDEVVHGKGSMFERAPQDEWRKFGTMRAFYAFMWAHPGKKLLFMGTEFGQ
RREFAETRSLDWDESAHWGHRGVQRLVKDLNTVYKAHPALYALDTDPAGFRWINADDAGG
NVFSWVRFDGDGQMIACITNFSADPRPDYRVGLPAEGAWVEIMNTDAAVYDGTGKIGNLG
QVIAHPVPSNGFPASANVTIPPLGAVWLLFQPTPTEESDEPEKVEAGTRAAAKQASPRRR
EPAAVEPAEEELAGEELADTGDEGSATPAKKTPARKSPAKKTPAKAAARKTSSAAAAKKA
TTKKTPAKSTATKKTTTRKSAAKKTTPPPEA
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaccccggcggtgagctgaccggttgggacctgaccgggttccatcagggg
catgacaccgaggcctggcgccggctcggtgcgcacgagatcacggtgaccgattccgag
cggggcgagatctcgggcacccggttctcggtctgggcgccgaatgcccaggcggtgcgg
ctggcgggcgacttcaactactggaacgacgagtcctcgccgatgcagctggtgccgggt
tccggggtctggtcgctgttcgtcgagggcgtcgggaccggcacgctctacaagttcgag
gtgctcggggccgatggtgtctggcggctgaaggcggatccgttcgcccggttctgcgag
gcgccgccgcacaacgcctcgatcgtgtacgagtcccagtacgagtggggcgacgaccag
tggctgtggttccggggccagaagaagcagtacgaggagccggtcagcatctacgaggtg
catctgggctcgtggcgcaagggcctcacctatgtcgagctcgctcggcagctggtggag
tacgtgtcctggcagggctacacccacgtcgagctgatgccggtcgccgagcacccgttc
gacgggtcctggggctatcacgtcaccggctactacgcgccgatctcccggttcggctcc
cccgacgagttccgctacctggtcgacgagctgcacaaggccggcatcggggtgctggtc
gactgggtcccgggtcacttcgccaccgatccgtgggcgctgcagcgcttcgacggcact
gccctgttcgagcacgaggatccgcggctgggctggcatcccgactggggctcctacatc
ttcaacttcggccgcaacgaggtgaagagcttcctggtctccaacgcctactactggctg
gacgagttccacatcgacgggttgcggatcgacgcggtcgcctcgatgctctatctggac
tactcccgcgaagccggccagtgggtgccgaacaagttcggcggcaacgagaacctcgag
gccgtcgagctgttgcagacggtgaacgcgcacaactaccggcgcaagcccgggatcatg
atggtcgccgaagagtcgacctcatggcccggagtcacccgagcggtcgacgacggcggc
ctgggattcggcttcaaatggaacatgggctggatgaacgactcgctccgctactacggg
cgagacccgctctaccggcagtatcaccaccacgagatgacgttcgcgatggcgtacgcg
tactcggagaacttcgtgctgccgatcagccacgacgaggtcgtgcacggcaagggctcg
atgttcgaacgggcgccgcaggacgagtggcgcaagttcggcacgatgcgggcgttctat
gccttcatgtgggcgcatccgggcaagaagctgctcttcatgggcaccgagttcggccag
cggcgggagttcgccgagacccgcagtctcgactgggacgagagcgcccactggggtcac
cgcggtgtgcagcgcctggtcaaggacctgaacaccgtctacaaggcgcatccggcgctg
tatgccctggacacggatccggccggcttccggtggatcaacgccgacgacgccggcggg
aacgtgttctcctgggtgcgcttcgacggcgacggccagatgatcgcctgcatcaccaac
ttctccgccgacccccggccggactatcgcgtcgggctgccggccgaaggggcctgggtg
gagatcatgaacaccgatgccgcggtctatgacggcaccggcaagatcggcaacctcggc
caggtgatcgcccatccggtgccctccaacgggttcccggcgtcggccaatgtgaccatc
ccgccgctcggtgcggtgtggctgctgttccagccgaccccgaccgaggagtccgacgag
ccggagaaggtcgaggccggtacgcgggcagcggccaagcaggcttcgccgagaaggcgc
gagcccgcggccgtggagccggccgaggaggaactggccggggaggaactggccgacacc
ggagacgaagggtcggcgacacccgcgaagaagacgccggccaggaagtctcctgccaag
aagactcctgccaaggcggcggcgcggaagaccagctcggccgcggcggcgaagaaggcg
accaccaagaagactcctgccaagtcgaccgctacgaagaagacgaccactcggaagtct
gcggcgaagaagaccaccccaccgccggaggcgtga

DBGET integrated database retrieval system