KEGG   Microlunatus phosphovorus: MLP_31740Help
Entry
MLP_31740         CDS       T01535                                 

Gene name
recD
Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mph  Microlunatus phosphovorus
Pathway
mph03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mph00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MLP_31740 (recD)
Enzymes [BR:mph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MLP_31740 (recD)
DNA repair and recombination proteins [BR:mph03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MLP_31740 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Viral_helicase1 Helicase_RecD AAA_22 UvrD-helicase PhoH AAA_16 SRP54 DUF2075 AAA_25 AAA NTPase_1 AAA_5 AAA_24 Mg_chelatase MukB AAA_28
Motif
Other DBs
NCBI-ProteinID: BAK36188
UniProt: F5XLC2
Position
3397509..3399362
Genome map
AA seq 617 aa AA seqDB search
MTAFSTEIAVASRAAGLLATFNTAGVLDLADVHVATAVTRISGEPDERVALALALAVRAL
RLGSVCIDLTTVAHEVFEAAEEGLDVAELPWPDPDDWSAQVSRSPAVADGAEAADGRPLR
LVSGKLYLERYWRQEESVRRQLVDRRAAPPPEVDVDRLAVALDRLFDRGGLGPEEEDLQR
RAAEVCAHQWVTVLAGGPGTGKTTTVAKVLAMLADQPGRQPRIALAAPTGKAAARLTEAL
SQARRQLAPEDAARVAELSALTLHRLLGWLPSTRGRFRHHAGNRLPYDVVVVDEMSMVSL
TMMARLLEAVRPDARLVLVGDPDQLSSVEAGAVLADITGALGVDALGVDGGGVDAGRTDG
GRRSVVRLQRTWRYGGAIEDLARAVRESDEDAAIEVLRRGADDVVFTETDLAHPRPAGIE
PLAAAVGAAGKELRDAAMAGDVTGALIALDRHRLLCAHRHGPYGVSRWSQEAERWLAEAV
PGYGEDGEWYLGRPLLITVNDYDLNLFNGDTGVVVATVGGVRAAFGRGSEPMLISPVRLD
AVQTTHAMTVHRAQGSQFDIVSFVLPPPDSPLLTRELLYTAVTRASHRVQVFGTEEAVRR
AVRRPANRASGLRGRLS
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgttcagcaccgagatcgcggtggccagccgggctgcgggactgctcgccacg
ttcaataccgcaggggtgctcgacctggccgacgtacacgtggccaccgccgtcacacgg
atcagcggcgagcccgacgaacgggtggctctggctctggctctcgcggtgcgcgcactg
cggctcggctcggtctgcatcgacctgaccacggtcgcgcacgaggtcttcgaggcggcc
gaagagggtttggacgtcgccgagctgccgtggccggacccggacgactggtcggcgcag
gtcagccggagtccggccgtcgccgacggggccgaggcagccgacgggcgtccactgcga
ctggtctcgggaaagctctatctggagcgctattggcgacaggaagagtcggtacgtcgc
cagttggtcgaccgccgcgccgcgccaccaccggaggtcgacgtcgaccggctggctgtc
gcgttggatcggttgttcgaccgaggtggtctgggtccggaggaggaagacctgcaacgg
cgggccgccgaggtctgcgcgcatcagtgggtgaccgtgctggccggcgggcccggcacc
ggaaagaccaccacggttgcgaaggtgttggcgatgctggccgaccagcctggtcggcag
ccacggatcgccttggcggcaccgaccggcaaggcggcggcccgtttgaccgaggcgctt
tcgcaggcccggcgtcagctggcgccggaggacgcagcccgagtcgccgagctgagcgcg
ctcaccctgcaccggctgctcggctggctgcccagcacccgcggtcggttccgtcaccac
gccggcaaccggctgccgtacgacgtggttgtggtcgacgagatgtcgatggtgtcgctg
accatgatggcccggctgctggaggccgttcgtcctgacgctcggctggtgttggtcggc
gatcccgaccagctctcctcggtggaggccggtgccgtgctggccgacatcaccggtgcg
ctcggcgtcgacgcgcttggggttgacgggggtggggttgatgctggccggaccgacggc
ggacggcgcagtgtggtccggctccagcgcacctggcggtatggcggcgcgatcgaggat
ctggcccgcgcggtccgggagagcgacgaggacgcggccatcgaggtgctgcgccgcggc
gccgacgatgtggtgttcaccgagaccgacctcgcccatccccgcccggccggcatcgag
ccattggcagcggccgtcggcgcggcgggcaaggaactgcgggatgccgccatggccggc
gatgtcaccggcgccctgatcgcactcgaccggcatcgcctgctgtgcgcccatcggcac
ggcccgtacggggtgtcccgctggagccaggaggcagaacgctggctggccgaggccgtg
cccggctacggcgaggacggcgagtggtatctggggcggccgctgctgatcaccgtgaac
gactacgacctcaacctgttcaacggcgacaccggcgtcgtggtggcgaccgtcggtggt
gtgcgtgccgcgttcgggcgtggctcagagccgatgctgatctcaccggtccggctggat
gccgtccagaccacccatgcgatgaccgtgcaccgcgcccaaggcagccagttcgacatc
gtctcgttcgtgctgccaccgccggactcccccttgctgacgcgggagttgctctacacc
gccgtcacccgagccagccaccgcgtgcaggtcttcggcaccgaagaggccgtacgccgc
gccgtccgccgcccggcaaaccgagccagcggactccgcggtcggttgagttga

DBGET integrated database retrieval system