KEGG   Microlunatus phosphovorus: MLP_31740Help
Entry
MLP_31740         CDS       T01535                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mph  Microlunatus phosphovorus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mph03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3397509..3399362
Genome map
AA seq 617 aa AA seqDB search
MTAFSTEIAVASRAAGLLATFNTAGVLDLADVHVATAVTRISGEPDERVALALALAVRAL
RLGSVCIDLTTVAHEVFEAAEEGLDVAELPWPDPDDWSAQVSRSPAVADGAEAADGRPLR
LVSGKLYLERYWRQEESVRRQLVDRRAAPPPEVDVDRLAVALDRLFDRGGLGPEEEDLQR
RAAEVCAHQWVTVLAGGPGTGKTTTVAKVLAMLADQPGRQPRIALAAPTGKAAARLTEAL
SQARRQLAPEDAARVAELSALTLHRLLGWLPSTRGRFRHHAGNRLPYDVVVVDEMSMVSL
TMMARLLEAVRPDARLVLVGDPDQLSSVEAGAVLADITGALGVDALGVDGGGVDAGRTDG
GRRSVVRLQRTWRYGGAIEDLARAVRESDEDAAIEVLRRGADDVVFTETDLAHPRPAGIE
PLAAAVGAAGKELRDAAMAGDVTGALIALDRHRLLCAHRHGPYGVSRWSQEAERWLAEAV
PGYGEDGEWYLGRPLLITVNDYDLNLFNGDTGVVVATVGGVRAAFGRGSEPMLISPVRLD
AVQTTHAMTVHRAQGSQFDIVSFVLPPPDSPLLTRELLYTAVTRASHRVQVFGTEEAVRR
AVRRPANRASGLRGRLS
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgttcagcaccgagatcgcggtggccagccgggctgcgggactgctcgccacg
ttcaataccgcaggggtgctcgacctggccgacgtacacgtggccaccgccgtcacacgg
atcagcggcgagcccgacgaacgggtggctctggctctggctctcgcggtgcgcgcactg
cggctcggctcggtctgcatcgacctgaccacggtcgcgcacgaggtcttcgaggcggcc
gaagagggtttggacgtcgccgagctgccgtggccggacccggacgactggtcggcgcag
gtcagccggagtccggccgtcgccgacggggccgaggcagccgacgggcgtccactgcga
ctggtctcgggaaagctctatctggagcgctattggcgacaggaagagtcggtacgtcgc
cagttggtcgaccgccgcgccgcgccaccaccggaggtcgacgtcgaccggctggctgtc
gcgttggatcggttgttcgaccgaggtggtctgggtccggaggaggaagacctgcaacgg
cgggccgccgaggtctgcgcgcatcagtgggtgaccgtgctggccggcgggcccggcacc
ggaaagaccaccacggttgcgaaggtgttggcgatgctggccgaccagcctggtcggcag
ccacggatcgccttggcggcaccgaccggcaaggcggcggcccgtttgaccgaggcgctt
tcgcaggcccggcgtcagctggcgccggaggacgcagcccgagtcgccgagctgagcgcg
ctcaccctgcaccggctgctcggctggctgcccagcacccgcggtcggttccgtcaccac
gccggcaaccggctgccgtacgacgtggttgtggtcgacgagatgtcgatggtgtcgctg
accatgatggcccggctgctggaggccgttcgtcctgacgctcggctggtgttggtcggc
gatcccgaccagctctcctcggtggaggccggtgccgtgctggccgacatcaccggtgcg
ctcggcgtcgacgcgcttggggttgacgggggtggggttgatgctggccggaccgacggc
ggacggcgcagtgtggtccggctccagcgcacctggcggtatggcggcgcgatcgaggat
ctggcccgcgcggtccgggagagcgacgaggacgcggccatcgaggtgctgcgccgcggc
gccgacgatgtggtgttcaccgagaccgacctcgcccatccccgcccggccggcatcgag
ccattggcagcggccgtcggcgcggcgggcaaggaactgcgggatgccgccatggccggc
gatgtcaccggcgccctgatcgcactcgaccggcatcgcctgctgtgcgcccatcggcac
ggcccgtacggggtgtcccgctggagccaggaggcagaacgctggctggccgaggccgtg
cccggctacggcgaggacggcgagtggtatctggggcggccgctgctgatcaccgtgaac
gactacgacctcaacctgttcaacggcgacaccggcgtcgtggtggcgaccgtcggtggt
gtgcgtgccgcgttcgggcgtggctcagagccgatgctgatctcaccggtccggctggat
gccgtccagaccacccatgcgatgaccgtgcaccgcgcccaaggcagccagttcgacatc
gtctcgttcgtgctgccaccgccggactcccccttgctgacgcgggagttgctctacacc
gccgtcacccgagccagccaccgcgtgcaggtcttcggcaccgaagaggccgtacgccgc
gccgtccgccgcccggcaaaccgagccagcggactccgcggtcggttgagttga

DBGET integrated database retrieval system