KEGG   Microlunatus phosphovorus: MLP_35290Help
Entry
MLP_35290         CDS       T01535                                 

Definition
transcriptional regulator
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mph  Microlunatus phosphovorus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mph00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3810542..3811687
Genome map
AA seq 381 aa AA seqDB search
MGLVSAASRPADRRQSPIELLTGFRVGVTSDRRSQDLISALERRGAEVLHAPALKIAPHD
QDTILVAETRALIEARPEVVLITTGYGMRRWLEVADTVGLGARLTEVLEDALILARGPKS
VGAIRAAGLEEEAASASDTTASLIDAVHQAGLTGRRVAIQLHGYTDEIQLARLRDLSARV
WTVTPYRWVPPAAPDRLTRLIEATCARHLDAVTFTSAPGAEATVAVAREIGLLDEFVAAL
ETDVLAVAVGPVTAGPLRDAGATVLAPDRHRLGALIRLVSEELAEHRVRRLRCGAAELEL
RGGAVLVDGRLITLSPNAFALLRTLAGTEGVARRADLQRCLPDGTDEHALDVAISRLRRS
LGVPGLVKTVVKRGYRLGAVR
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgggactcgtgagcgcagcgtcccgtcctgcggaccgccggcagagtccgattgagctg
ctcaccggattccgggtcggggtgacctccgatcgccggtcccaggacctgatctcggcc
ctggaacgccggggcgccgaggtgctgcacgctccggcactgaagatcgcgccccacgac
caggacaccatcctggtcgccgagacgcgggcgctgatcgaggctcgtcccgaggtggtc
ttgatcaccaccggatatgggatgcgtcgttggctcgaggttgcggacacggtcgggctc
ggggcacgactcaccgaggtcttggaggatgcgctgatcctcgctcgcggaccaaaatca
gtgggtgcgatccgggccgccgggctcgaagaggaagctgccagcgcgagcgacaccacc
gcatccctgatcgacgcggtgcatcaggcgggcctgaccggccggcgcgtcgccatccag
ctgcacggctacaccgacgagatccagctcgcccggttgcgcgacctcagcgcccgcgtg
tggaccgtgacgccctaccgctgggtgccgccggccgccccggaccggctgacccggctg
atcgaggccacctgcgccaggcacctcgatgccgtgacgttcaccagcgcacccggcgcc
gaggccaccgtggcggtggctcgggagatcggcctgctggacgagttcgtcgcagcactg
gaaaccgacgtccttgccgtcgcggtcggtccggtgaccgccggaccgctgcgcgacgcc
ggcgcaacggtgctggctccggaccgtcatcggctcggtgcactcatccggttggtcagc
gaagagctggccgagcaccgcgtacgccgtcttcgctgcggcgcagccgaactggagctg
cgcggcggggcggtgctggtggacggacgactgatcaccctcagccccaacgccttcgct
ctgctccggaccctggccggcacggaaggggtcgcccgacgagccgacctgcagcggtgt
ctcccggacggcaccgatgagcacgcactcgatgtcgcgatcagccgactccgccgatcc
ctcggcgttcccggtctggtgaagacggtggtcaagcgtggctaccggctgggcgccgta
cgctaa

DBGET integrated database retrieval system