KEGG   Microlunatus phosphovorus: MLP_35810Help
Entry
MLP_35810         CDS       T01535                                 

Gene name
res
Definition
type III restriction-modification system restriction subunit (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
mph  Microlunatus phosphovorus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3864724..3867801)
Genome map
AA seq 1025 aa AA seqDB search
MKLQFKVQQYQTDAVDAVVETFAGQPKYDGIAYRIDPGRARPVTAPALFEAEERPDAGLR
NAEIALSGAQLLENVHAVQRSRNLPLSAKLAFSAAAPGAPNLDVEMETGTGKTYVYIKTI
MELHKRYGWSKYIIVVPSVAIREGVKKSFDVTAEHFQQLYGTKPRSFIYNSTQLHELERF
SSDAGVQVMIINIQAFNAQGKDQRRIYDELDDFQSRRPIDVIKANRPIVIIDEPQKISAD
KSLKALAEFNALMLLRYSATHKVEHTKVHRLDALDAYNQKLVKKIAVRGITVKGLAGSTA
YLYLDAIEIAKGAKPRARVEIEVQTAAGIKRQIKRLDMGSNLHAVSNGIEAYKDLFVTEV
DANRDVIELSNGDVVVAGQLADRDVTEETKRRIQIREVVRAHLDKERELFSQSVKVLSLF
FIDEVAKYRDYSREDTLGDYARVFEEEYAAIRDEVLGELTIDAATEEYQTYLRRDDVRKV
HEGYFSIDKKTKHQIDGKVSGRGDDKGQSTDTDAYDLILKDKERLLSFAEPVRFIFSHSA
LREGWDNPNVFVMGMLKKSDNTVSRRQEIGRGLRLAVDQHGERMDNPVTVHDINELTVVT
DESYTDFVAGLQREISESLAARPRKASVKFFVGKTIQTPSGESVIEEAVAQALYKYLVKN
DYVNEDDTISEAYKQAKESRTLAAPTSEALKTVIDFVWPLVDALYLDLPVPTDDRKPKKI
PLNEANFARKEFQALWGRINHRAVYQVEFDSAELISKSIEHLDQNLNVAALQYVVQAGQQ
REQLEADDLTSGTGFAVQTTRTHTETVSAGSQVKYDLLGEITEKTHLTRRTVAAILRGVT
PATFAKFRLNPEQFITEAARLINEQKATVIVEHLAYDALEDRFDSAIFTENQTAQDFSKA
GSKLKKHVYDYVVTDSKIERKFVTELDTSHEVAVYAKLPRGFFIPTPVGDYNPDWAIAFT
EGSVKHVYFVAETKGSLSTLQLKGVEDAKIECARRFFEKIAQSHGQDVTYGVVTDYTELM
QLVSA
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccagttcaaggtccagcagtaccagaccgatgccgtcgatgctgtcgtcgag
accttcgccgggcagccgaagtatgacggtatcgcctaccggatcgaccccggcagggct
cgtcccgtgaccgcgccggcactgttcgaggcggaggagcgcccggacgccggcctgcgc
aacgctgagatcgctctttcaggagcgcagttgttggagaatgtgcatgcggtgcagcgt
tcgcggaacctcccgctgtcggccaagctcgccttcagtgccgccgctccgggggctccg
aacctcgatgtggagatggagacgggcaccggcaagacctacgtctacatcaagacgatc
atggagctacacaagcggtacggctggtcgaagtacatcatcgtggtgccgtcggtcgcg
atccgcgagggcgtgaagaagtcgttcgacgtgactgccgagcacttccagcagctctac
ggcaccaagccgcgctcgttcatctacaactcgacccagctgcacgagcttgagcggttc
agctccgatgccggggtgcaagtgatgatcatcaacatccaagcgttcaatgcgcagggc
aaggaccagcgccgcatctatgacgagcttgacgacttccagtcccgccgcccgatcgac
gtgatcaaagccaaccgcccgatcgtgatcatcgacgagccgcagaagatcagtgccgac
aagtcgctcaaagcgctggctgagttcaacgcgttgatgctgctgcggtactcggcgacg
cacaaggttgaacacaccaaggtgcaccggctcgacgcgctcgatgcgtacaaccagaag
ctcgtgaagaagatcgccgtgcgcggcatcaccgtgaagggtctcgccggctcgactgcc
tacctgtacctggatgccatcgagatcgcgaagggcgccaagcctcgcgcgcgggtcgag
atcgaggtgcagacggcggcaggcatcaagcggcagatcaagcgcctcgacatgggctca
aacctgcatgctgtgtcgaacgggatcgaagcatacaaagacttgttcgtcaccgaggtg
gacgccaaccgtgacgtgatcgagctgagcaacggcgatgtggttgtggcggggcagctc
gccgaccgggatgtcaccgaggagaccaagcggcgcatccagattcgcgaggtagtccgt
gcccatctggacaaggagcgcgagctgttcagccagagcgtcaaggtgctctcgctgttc
ttcatcgacgaggtcgccaagtaccgcgactacagccgcgaagacaccctcggtgactat
gcgcgcgtgtttgaggaggagtacgcggcgatccgcgacgaggtgcttggcgaactcacc
atcgacgcggcgaccgaggagtaccagacctacctgcgccgtgacgacgtacggaaggtg
cacgagggctacttctccatcgacaagaagaccaagcaccagatcgacggcaaagtctcc
ggacgcggggacgacaagggccagtccaccgacaccgacgcgtacgacctgatcctcaaa
gacaaggaacgcctgctgtcgttcgccgaacctgtccggttcatcttctcccactcggca
ctgcgcgagggctgggacaaccccaacgtgttcgtcatgggcatgctcaagaagagcgac
aacaccgtctcccgccgccaggagatcggacgaggcctgcggttggcggtcgaccaacac
ggcgaacggatggacaaccccgtcaccgtgcacgacatcaacgaactgactgtcgttacc
gacgagtcctacaccgacttcgtggccggcctccaacgcgaaatctccgagtcgctagcc
gcacggccacgcaaggccagtgtcaagttcttcgtcggcaagaccatccagacaccatct
ggtgagtcggtcatcgaggaagccgtcgcccaggcgctctacaagtatctggtcaagaac
gactacgtgaacgaagacgacacgatctccgaggcctacaagcaggccaaggaatccagg
actctcgccgcgccgacctccgaggcgctcaagacggtcatcgacttcgtgtggccgctg
gtcgacgccctctacctggacctgccggtgcccaccgatgatcgcaaaccgaagaagatc
ccgctgaacgaagccaacttcgcccgcaaggagttccaagcgttgtggggtcggatcaac
caccgcgccgtttaccaggtcgagttcgactcagcggagctgatcagcaagtccatcgag
cacctcgaccagaacctcaacgtcgcggcgctgcagtacgtcgtgcaagccggccaacag
cgggagcaactggaggctgatgacctcaccagcggtacgggcttcgcggttcagaccacg
cggacgcacacggagaccgtgagcgcgggctcacaggtgaagtacgacctgcttggagag
atcaccgagaagacccatctcacccgccgtaccgttgctgcgatcctccgcggggtcacg
ccagcaacctttgccaagttccgcctcaacccggagcagttcatcaccgaggcggcgcga
ctcatcaatgagcagaaggccacggtcatcgtcgagcatctcgcctatgacgcgctcgaa
gaccggtttgactctgcgatcttcaccgagaaccagaccgcccaggacttctcgaaggct
gggtcgaagctcaagaagcacgtgtacgactacgtggtcaccgactccaagatcgagcgc
aagttcgtcaccgaactcgacaccagccacgaggtcgccgtctacgcgaagctcccgcga
ggattcttcatccccacgccagtcggcgactacaaccccgactgggccatcgccttcacc
gagggcagcgtgaagcatgtctacttcgtcgctgagaccaagggctcgctgtccacactc
cagctcaagggcgtcgaggacgccaagatcgagtgcgctcgtagattcttcgagaagatt
gcccagagtcacggccaggacgtcacctatggcgtcgtcaccgactacaccgagctgatg
caactcgtttcggcgtag

DBGET integrated database retrieval system