KEGG   Microlunatus phosphovorus: MLP_38770Help
Entry
MLP_38770         CDS       T01535                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00670  One carbon pool by folate
mph00790  Folate biosynthesis
mph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MLP_38770 (folA)
   00670 One carbon pool by folate
    MLP_38770 (folA)
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MLP_38770 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: BAK36891
UniProt: F5XQ60
Position
complement(4178097..4178576)
Genome map
AA seq 159 aa AA seqDB search
MIGIAAVARNGVIGAGNDIPWRIKEDWARFKAITMGHVLIMGRKTYDSIGRPLPGRTTIV
VTRDPDWTADGIRTAHNLDDAFEVAYALAPEKVFVAGGGQIYAAAWDRLDVLEITEVDIE
PAGEVRFPLIGPEWVVVSREQADGYAFVTLEKDTESILN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgatcggtatcgccgccgtcgcccgcaacggcgtgatcggcgcaggcaatgacatccca
tggcggatcaaggaggactgggcccggttcaaggcgatcaccatgggccacgtcttgatc
atgggtcgcaagacgtatgactcgatcggccgtccgctgcccggccggacgaccatcgtg
gtgactcgtgatcccgactggaccgccgacggcatccggaccgcccacaacctggatgac
gcgttcgaggtggcgtacgcgttggcgccggagaaggtgttcgtggcaggcggcgggcag
atctatgccgcggcctgggaccggctggacgtcttggagatcaccgaggtcgacattgaa
ccggccggcgaggtgcgtttcccgctgatcgggcccgagtgggtggtggtcagccgcgag
caggcggacggctatgccttcgtcaccctcgagaaggatactgaatcgatactgaattag

DBGET integrated database retrieval system