KEGG   Microlunatus phosphovorus: MLP_38860Help
Entry
MLP_38860         CDS       T01535                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mph  Microlunatus phosphovorus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MLP_38860 (rbsK)
Enzymes [BR:mph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MLP_38860 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4186498..4187346
Genome map
AA seq 282 aa AA seqDB search
MTKKPMAPALCVVGSINLDIIATTERLPGPGETVGGGVLSHQPGGKGGNQAAAAARLGAQ
VRMIGAIGSDEGGDRVLAAMAAAGVQTESVQRVSAATGTALIVVDEDGQNQIAVCPGAND
ALDLTEAEFGSDEAVLCQLEISLEVVLEAARRAPGFFAINASPSQPIPAELRDRCDLVIV
NETEAEQMPELASAKVLVITYGSKGASLLRQGREVASVPSPKVEVVNTIGAGDAFCAAMV
LALNSGESDEDALRIACAVGADAVTDAASQPRLGPLSGYRQD
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaaagccgatggcccccgcgctctgtgtcgtgggcagcatcaacctcgacatc
atcgccacgaccgagcggctccccggcccaggcgagaccgtgggtggtggtgtgctgagc
catcagccgggcggcaagggcggcaatcaggcagcggccgccgcgcggctgggagcgcag
gtgcggatgatcggtgccatcggaagtgatgagggcggcgatcgagtgctggccgcgatg
gccgcggccggggtgcagaccgagtccgtacaacgagtctcggctgccacgggcacagcc
ctcatcgtcgtcgacgaggacggccagaatcagatagccgtctgccccggcgccaacgac
gccctcgatctgaccgaggcggagttcggttcggacgaggccgtgctgtgccagctggag
atctccctggaggtcgttctggaggctgcccgacgggcaccgggcttcttcgccatcaac
gcctcaccttcccaaccgatccccgccgagcttcgtgaccggtgcgatctggtgatcgtg
aacgaaaccgaagcggagcagatgcccgagctggcctcggccaaggtgctggtgatcacg
tacggctccaagggcgcgtccttgctgcgtcaggggcgagaggtggcgtcggtgccctcg
ccgaaggtcgaggtcgtcaacacgatcggtgccggggacgccttctgcgcggcgatggtg
ctggcgctgaacagcggcgagagtgacgaggacgcgcttcgaatcgcctgcgcggtcggc
gcggatgccgtgaccgacgcggcgtctcagccacggttgggccccctgtccggctaccga
caggactga

DBGET integrated database retrieval system