KEGG   Microlunatus phosphovorus: MLP_38960Help
Entry
MLP_38960         CDS       T01535                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mph  Microlunatus phosphovorus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MLP_38960 (pncA)
Enzymes [BR:mph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MLP_38960 (pncA)
    3.5.1.-  
     MLP_38960 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4195792..4196367
Genome map
AA seq 191 aa AA seqDB search
MTGGTRALIVVDVQNDFCEGGSLAVAGGAEVGRRIAELIADEHGYDHVIATRDHHIDPGD
HFSEHPDYVHSWPVHCVAGTAGAELHPNLGDTRFEAIFDKGEYAAAYSGFEGKCDGEPLA
DWLHSREVTDVDVCGIATDYCVKATALDAARNGFDTTVLLDLTAAVAPANTAEVITEWAA
ARVAVETEGIR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaggcaccagggcgctgatcgtcgtcgacgtgcagaacgacttctgcgagggc
gggtcgctggcggtggccggcggcgccgaggtcggacgacggatcgcggagctgatcgcc
gatgagcacggctacgaccatgtgatcgccacccgcgaccaccacatcgatccgggcgat
cacttctccgagcaccccgactacgtccactcctggccggtgcactgtgtggccggcacc
gccggcgctgaactgcacccgaatctcggtgacaccaggttcgaggcgatcttcgacaag
ggcgagtatgcggccgcgtactcgggcttcgaggggaagtgcgacggcgagccgctggcc
gactggctgcacagccgggaggtgaccgacgtggatgtctgcgggatcgcgaccgactac
tgcgtcaaggccaccgcgctggacgcggcccgcaacggcttcgacaccacggtcctgctg
gacctgaccgccgccgtagctcccgccaacacggccgaggtgatcaccgaatgggccgcg
gcccgtgtcgcggtcgagaccgagggaatacggtga

DBGET integrated database retrieval system