KEGG   Microlunatus phosphovorus: MLP_39310Help
Entry
MLP_39310         CDS       T01535                                 

Gene name
cofE
Definition
F420-0--gamma-glutamyl ligase (EC:6.3.2.-)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mph  Microlunatus phosphovorus
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mph00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4232989..4233894
Genome map
AA seq 301 aa AA seqDB search
MPTDSAIALFAPAGIGEVAPGTDLVELLTAAISADEHGPLRPGDIVVVTSKIISKAEDRY
ADAADREAAIAAESTRTVVRRGSMRIVRTRTGLTIAAAGVDNSNVAPGRILLLPLDPDAS
AERLAAGLSEAAGGDVGVIVSDTAGRPWRLGQTDHAIGAARVRVLESYAGKTDPYGNELA
VTTMALADELAAAADLVKRKLAGRPVAVIRGLSELVGPQPEEAAGATTIVRTGPDDLFSH
GSREAVLAALCRALGVPEAYEELVGAGPQTATTQLLQTGTLPVDAADLIRSLLLDQQAPQ
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgccgactgactctgcgatagcgctcttcgccccggcgggcatcggggaggtggccccc
gggaccgatctggtcgagctactcaccgccgcgatcagcgccgatgagcacggaccgctg
cggcccggggacatcgtcgtcgtcacttccaagatcatcagcaaggcggaggaccggtac
gccgacgccgccgatcgggaggcggcgatcgcggccgagagcacccgtaccgtggttcgg
cgcgggtcgatgcgcatcgtccgtacccgaaccgggctgacgatcgcggccgcgggcgtg
gacaactccaacgtggcaccagggcggatcctgctgctgcccctcgacccggacgcctcc
gccgagcggctggcagccgggctcagcgaagccgcgggcggcgacgtcggggtgatcgtc
tccgacacggccggccggccgtggcggctcggacagaccgatcacgcgatcggcgcggcc
cgggtccgagtgctggagagctatgccggcaagaccgatccgtacggcaatgagctggcc
gtcaccacgatggcgctggcggacgaactggccgccgctgcggacctggtgaaacgcaag
ctggccggccggccggtggcagtgatccgcggtctgagcgagctggtcggtccgcagcct
gaggaagccgccggcgcgaccacgattgtccggaccggacccgacgacctgttcagccac
gggtcgcgcgaggcggtgctggctgcactgtgccgcgcgctcggcgtacccgaggcgtac
gaggaactggtcggcgccggcccgcagaccgcgaccacacaactgctgcaaaccggcacg
ctgccggtcgatgccgcagacctgatccgctccctgctgctcgatcagcaggcgcctcag
gcgtag

DBGET integrated database retrieval system