KEGG   Microlunatus phosphovorus: MLP_40990Help
Entry
MLP_40990         CDS       T01535                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MLP_40990 (glpK)
Enzymes [BR:mph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MLP_40990 (glpK)
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MLP_40990 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4386502..4388022)
Genome map
AA seq 506 aa AA seqDB search
MSSNTYVMAIDQGTTSSRAIIFDHGGQIASTGQVEHEQIFPRAGWVEHDPVEIWTNVREV
VAFALSSADIDARDVVAIGITNQRETAVVWDRHTGKPVYNAIVWQDTRTKAIVEELGGDA
GPDRFKDLVGLPLATYFTGPKVKWILDNVEGARARAEAGDLLMGTTDSWVLWNMTGGAVN
GIHVTDVTNASRTMLMNIDTLDWNADICAEMGIPLSMLPEIRSSSEVYGIVRPAGLMAGV
PVAGILGDQQAATFGQACFEKGMAKNTYGTGSFLLLNTGTTPVRSKNGLLTTVCYKIGNA
PTVYALEGSIAVTGSLVQWIRDNLEMIDDASEIEGLARSVDDNGGAYIVPAFSGLFAPYW
RSDARGALVGLTRFVRKGHLCRAVLESVAYQTRDVVEAMNADAQTELKELKVDGGMTGNE
LLMQFQADQLGVDVVRPQVAETTALGAAYAAGIAVGYWNGEQDVIDNWAEGKRWTPKSGN
GECARQYRNWKKAVQRTLDWVDEDVL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacacctacgtcatggcgatcgaccagggcaccaccagcagccgggcgatc
atcttcgaccacggcggtcagatcgcgtccaccggacaagtggagcacgagcagatcttt
ccccgagccggctgggtcgagcacgacccggtggagatctggaccaatgtccgcgaggtc
gtcgccttcgccttgtcgtcggccgacatcgatgcccgtgacgttgtcgcgatcggcatc
accaaccagcgtgagaccgcggtcgtctgggaccgccacaccggcaagcccgtctacaac
gccatcgtctggcaggacacgcggaccaaggcgatcgtggaggagctcggcggcgacgcc
ggtccggaccggttcaaggatctggtcgggttgccgctggccacctacttcaccggcccc
aaggtgaagtggattctcgacaacgtcgagggtgctcgggctcgcgccgaggccggcgac
ctgttgatgggcaccacggacagctgggtgctgtggaacatgaccggcggtgccgtgaac
ggcattcacgtgaccgacgtcaccaacgcttcccgcaccatgctgatgaacatcgacacc
ctcgactggaatgccgacatctgtgccgagatggggatcccgctgtcgatgctgcccgag
atccgctcctcctcggaggtgtacggcatcgtccggccggccggcttgatggcgggcgtc
ccggtcgccgggatcctcggagaccagcaggccgccaccttcggtcaggcgtgcttcgag
aagggcatggccaagaacacgtacggcaccggcagcttcctgctgctcaacaccggcacc
actccggtacgcagcaagaacggcctgctcaccaccgtctgctacaagatcggcaacgcc
ccgacggtgtacgcgctcgagggatccatcgccgtgaccgggtctctcgttcagtggatc
cgggacaacctcgagatgatcgacgacgcgtccgagatcgagggtctcgcccgcagcgtg
gacgacaacggcggcgcctatatcgtcccggccttctccggtctgttcgccccctactgg
cgctccgacgccaggggtgctctcgtcggcctcacccgcttcgtccgcaaaggccacctc
tgccgggccgtgctggagtcggtcgcgtaccagacgcgcgacgtggtcgaggcgatgaac
gccgacgcccagaccgagctgaaggagctgaaggtcgatggcgggatgaccggcaacgag
ctgctgatgcagttccaggccgaccagctcggtgtcgacgtcgtccggccacaggtcgcc
gagaccacggcgctcggcgccgcctacgccgccgggatcgccgtcggctattggaacggt
gagcaggacgtcatcgacaactgggccgaaggcaagcggtggacaccgaagtccggcaac
ggcgagtgcgcccggcagtaccgcaactggaagaaggccgtccaacggactctcgactgg
gtcgacgaagacgtcctctag

DBGET integrated database retrieval system