KEGG   Microlunatus phosphovorus: MLP_41640Help
Entry
MLP_41640         CDS       T01535                                 

Definition
esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mph  Microlunatus phosphovorus
Brite
Enzymes [BR:mph01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MLP_41640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4459011..4459844
Genome map
AA seq 277 aa AA seqDB search
MTSLLSRALEPVVRLVDRFHGRDEPTPPAFVDDPAIQPYAAGEGPIGVLLVHGFTGTPQS
MRPWAEHLAAAGYAVSLPRLPGHGTHWKELNATQWIDWYAHIEAAFNELRERCAQTFICG
LSMGGALSLRLAEQHGDAVSGLVLVNPAINITDPRMKVLPVLSRLVPSLSAIGNDVADPA
AREIAYDRNPLRALHSQSKLWADVVAHLDLVTQPLLVFRSEQDHVVDPSSVAILKERVGS
ADAEFRTLTRSFHVATLDYEAQEIFDASVEFIGRLSS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcactgctgagcagagccctggagccggtggtccgactcgtcgatcgctttcac
ggccgcgacgaaccgacgccgccagcttttgtcgacgacccggccatccagccgtacgca
gccggagagggcccgatcggggtcctactcgtgcacgggttcaccggcactccccagtcc
atgcgcccttgggcagagcacctggccgcggccggttacgccgtgtcactgccccggttg
cccgggcacggaacccactggaaggagctcaacgccactcagtggatcgactggtatgcc
cacatcgaggctgcgttcaacgagttgcgggagcgctgtgcgcagaccttcatctgtggt
ctgtcgatgggtggtgcgctgagcctgcggctggccgagcagcatggcgacgcggtctcc
ggtctggtcctggtcaacccggctatcaacatcaccgacccgcggatgaaagtcctgccg
gtgctgtcccggctcgtgccgtctctttcggccatcggcaacgacgtcgccgacccggcg
gcccgagaaatcgcctatgaccgcaacccactgcgcgcgctgcactcccagagcaagctg
tgggccgatgtcgtcgcccatctcgatctggtcacgcagccgctgctggtcttccgctcc
gaacaggaccacgtcgtcgacccctcctcggtggcgatcctgaaagagcgggtcggctcc
gcggatgccgaattccgcaccctgacccgcagcttccacgtggcgaccctcgactacgag
gcccaggagatcttcgacgcgtccgtggagttcatcggtcgcctctcgtcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system