KEGG   Microlunatus phosphovorus: MLP_41670Help
Entry
MLP_41670         CDS       T01535                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00010  Glycolysis / Gluconeogenesis
mph00052  Galactose metabolism
mph00500  Starch and sucrose metabolism
mph00520  Amino sugar and nucleotide sugar metabolism
mph00521  Streptomycin biosynthesis
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01120  Microbial metabolism in diverse environments
mph01130  Biosynthesis of antibiotics
mph01200  Carbon metabolism
Module
mph_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_41670 (glk)
   00052 Galactose metabolism
    MLP_41670 (glk)
   00500 Starch and sucrose metabolism
    MLP_41670 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    MLP_41670 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MLP_41670 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MLP_41670 (glk)
Enzymes [BR:mph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MLP_41670 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: BAK37181
UniProt: F5XRW8
Position
complement(4461646..4462695)
Genome map
AA seq 349 aa AA seqDB search
MSASHADHDSAALPLSVGIDIGGTKVAAGVVDPGGGIAERLQIPTPSRSPQAVEDAIVDL
VTELCAKHEGVESVGIGAAGWVDSTQSIVRFSPHLAWREEPLKQRLHQRIDLPLIVDNDA
NAAAWAEYRFGAGQGSSVMVCITLGTGIGGGLVLNGDLFRGAYGMAGEWGHMISVPGGHR
CECGNRGCWEQYASGNALVREAKELASSNSPMAFRLLEMLGGDPETITGPEVTAAAVAGE
QTAIELLADVGQWLGQGIANLAAALDPDLVVIGGGVSAAGDLLLQPARQMFARTLTGRGF
RQQARLELAHFRNDAGLIGAADLARHAVLNPPMSDCGGFWPGRGYDRQE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcgtcgcacgctgaccacgactccgcagccctaccgctcagcgtcggcatcgac
atcggtggcaccaaggtcgccgccggcgtcgtcgacccgggcggtggcatcgccgaacgg
ctgcagataccgaccccgtcgcgcagcccacaagcggtggaggacgcgatcgtggacctg
gtgaccgagctgtgcgccaagcacgagggcgtggaatcggtgggcatcggcgcggccggt
tgggtggacagcacccagtccatcgtccgcttctcgccgcatctggcctggcgggaggaa
ccgctcaagcagcggctgcaccagcggatcgacctgccgctgatcgtcgacaacgatgcg
aatgcggctgcctgggccgagtatcgattcggtgccggccagggttcgtcggtgatggtc
tgcatcaccctcggcaccggcatcggcggtggcctggtgctcaacggcgacctcttccgt
ggcgcctacgggatggccggcgagtggggccacatgatcagcgttcccggcgggcaccgc
tgcgagtgcggcaatcgtggctgctgggagcagtacgcctccggcaatgcactggtccgc
gaggccaaggaactggccagctccaactcaccgatggccttccggctgctggagatgctc
ggcggcgacccggagacgatcaccgggccggaggtgacagctgcggcggtggcgggggag
cagaccgcgatcgagctgctggccgatgtcggacagtggctgggacagggcatcgccaac
ctcgccgccgcgctggatccggatctggtggtgatcggcggtggcgtgagcgcggccggt
gacctgctgctgcagcctgctcgccagatgttcgcgcgcaccctgaccggccgcgggttc
cgccagcaggcgcggctcgagctcgcgcacttccgcaacgacgccggcctgatcggtgcc
gccgaccttgcccggcacgccgtcctcaaccccccaatgtccgactgcggcggcttctgg
cccggccgcggctacgaccgccaggagtag

DBGET integrated database retrieval system