KEGG   Microlunatus phosphovorus: MLP_42230Help
Entry
MLP_42230         CDS       T01535                                 

Definition
dihydrolipoamide acyltransferase (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mph  Microlunatus phosphovorus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_42230
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MLP_42230
  Amino acid metabolism
   00310 Lysine degradation
    MLP_42230
Enzymes [BR:mph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MLP_42230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4514802..4516727
Genome map
AA seq 641 aa AA seqDB search
MLLWLGWPPPLRSGQTRPASDPVPRQKESKHPMSTSVTLPALGESVTEGTVTRWLKQVGD
RVEADEPLLEVSTDKVDTEIPSPVSGVLLEIKAAEDETIEVGAALAVIGDADEAASSDGG
DSAAAAPAPAAPEAAAPDPEPAATSESQAPAASSSAPAGGAGTEVTLPALGESVTEGTVS
RWLKQVGDTVDADEALLEISTDKVDTEIPSPVAGTILEIRVSEDETVEVGAVLAVIGDAS
QAGAPEPEPEPEPEPEPEPEPEPAPKPAPAAARSAAESLPLQRAAEPPAPAAPAPAAPAP
AAPAPAAPAADGDRSYVTPLVRKLAAEHNVDLSTIQGTGVGGRIRKQDVLAAAEAAKRAA
EAAAKAEAAAKAAAAQPAAAPAAAPTASPAPAKKPAAEPSGLRGTTEKMSRMRKTIARRM
VESLQTSAQLTATVEVDLTAVSRIRAQAKDAFKAREGASLSYLPFITKAAVEALKVFPKL
NAIVDTEAGEISYPSAEHIGIAVDTERGLMVPVIKDAGDLNIAGLAKKIGDLAARTRKNK
VTPDELSGGTFTITNYGSAGTLMDTPIINQPQVAILGTGALVKRPVVLTDPVLGEVIAVR
DMMYLSMSYDHRIVDGADAARFLSAVKARLEEGDFGSEFGV
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgctcctatggctaggctggcccccaccgttacgctcaggtcaaacgcgaccagcgtct
gacccggttccgcgccagaaggagtccaaacaccccatgtcgacttccgtaacccttccc
gccctcggcgaaagcgtcaccgagggcacggtcacccggtggctgaagcaggtgggcgac
cgtgtcgaggctgacgaacccttgctcgaggtctcgaccgacaaggtcgacaccgagatc
ccgtcacccgtgtccggcgtgctgctggagatcaaggccgctgaagacgagaccatcgag
gtcggcgcggccctggccgtgatcggggacgccgacgaggcagcgagcagcgacggcggc
gactccgccgctgcggcgcccgccccggcagctccggaggcggcagcgcccgacccggag
ccggcggcgacgtccgagtcccaggcgcccgcggccagcagttccgcgcccgccggcggg
gccggcaccgaggtgaccttgccggcgctcggcgagagcgtgacagaaggcaccgtgagc
cgctggctgaagcaggtcggtgacacggtcgatgccgacgaggcactgctggagatctcc
accgacaaggtcgacaccgagatcccctcgcctgtcgccggcacgatcctcgagatcagg
gtcagcgaggacgagaccgtagaggtcggcgccgtactggctgtgatcggtgatgcgtcc
caggccggggcgcccgagccggagcctgagcccgaaccggagccggaacccgagcccgag
ccggaaccagcgcccaagcccgctccggcggccgcgcggtcggccgccgagtccttgccg
ctgcagcgcgcggccgagccgccagccccggcagcaccggctccagcggccccagctccg
gcggccccagctccggcagcaccggcagccgatggggatcgcagctacgtcaccccactg
gtccgcaagctggccgctgagcacaatgtcgacctgtcgacgattcagggcaccggggtc
ggcggccgaatccgcaagcaggacgtgctggctgcggcggaagccgccaagcgggccgcg
gaggcggcagcgaaggcggaggccgcggccaaggcagcggcggcgcagccagctgcggct
ccggcggcagccccgaccgcgagcccggcaccggccaagaagccggctgccgagccgagc
ggtctgcgcggcaccaccgagaagatgtcgcggatgcgcaagacgatcgcccggcggatg
gtcgagtcgctgcagacctcggctcagctcaccgccaccgtggaggtcgacctcaccgcg
gtgtctcgcatccgtgcccaggccaaggacgccttcaaggcccgcgagggtgcgagcctg
tcgtacctgccgttcatcaccaaggccgccgtcgaggcgctcaaggtcttcccgaagctc
aacgccatcgtcgacaccgaggccggcgagatctcctacccgagcgcggagcacatcggc
atcgccgtggacaccgagcgcggtctgatggttccggtgatcaaggacgccggtgacctc
aacatcgccggcctggccaagaagatcggcgatctggcggcccggacccggaagaacaag
gtcacccccgacgagttgagcggtggcaccttcaccatcaccaactacggctcggccggg
accctgatggacaccccgatcatcaatcagccgcaggtcgccatcctgggcaccggtgcg
ctggtcaagcggccggtggtgctcaccgatccggttctcggagaggtcatcgccgtgcgg
gacatgatgtatctgtcgatgtcgtacgaccatcggatcgtcgacggcgctgatgccgct
cgcttcctgtccgcggtcaaggcccgactggaagaaggcgacttcggctccgagttcggg
gtctag

DBGET integrated database retrieval system