KEGG   Microlunatus phosphovorus: MLP_42230Help
Entry
MLP_42230         CDS       T01535                                 

Definition
dihydrolipoamide acyltransferase (EC:2.3.1.-)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mph  Microlunatus phosphovorus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_42230
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MLP_42230
  Amino acid metabolism
   00310 Lysine degradation
    MLP_42230
Enzymes [BR:mph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MLP_42230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4514802..4516727
Genome map
AA seq 641 aa AA seqDB search
MLLWLGWPPPLRSGQTRPASDPVPRQKESKHPMSTSVTLPALGESVTEGTVTRWLKQVGD
RVEADEPLLEVSTDKVDTEIPSPVSGVLLEIKAAEDETIEVGAALAVIGDADEAASSDGG
DSAAAAPAPAAPEAAAPDPEPAATSESQAPAASSSAPAGGAGTEVTLPALGESVTEGTVS
RWLKQVGDTVDADEALLEISTDKVDTEIPSPVAGTILEIRVSEDETVEVGAVLAVIGDAS
QAGAPEPEPEPEPEPEPEPEPEPAPKPAPAAARSAAESLPLQRAAEPPAPAAPAPAAPAP
AAPAPAAPAADGDRSYVTPLVRKLAAEHNVDLSTIQGTGVGGRIRKQDVLAAAEAAKRAA
EAAAKAEAAAKAAAAQPAAAPAAAPTASPAPAKKPAAEPSGLRGTTEKMSRMRKTIARRM
VESLQTSAQLTATVEVDLTAVSRIRAQAKDAFKAREGASLSYLPFITKAAVEALKVFPKL
NAIVDTEAGEISYPSAEHIGIAVDTERGLMVPVIKDAGDLNIAGLAKKIGDLAARTRKNK
VTPDELSGGTFTITNYGSAGTLMDTPIINQPQVAILGTGALVKRPVVLTDPVLGEVIAVR
DMMYLSMSYDHRIVDGADAARFLSAVKARLEEGDFGSEFGV
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgctcctatggctaggctggcccccaccgttacgctcaggtcaaacgcgaccagcgtct
gacccggttccgcgccagaaggagtccaaacaccccatgtcgacttccgtaacccttccc
gccctcggcgaaagcgtcaccgagggcacggtcacccggtggctgaagcaggtgggcgac
cgtgtcgaggctgacgaacccttgctcgaggtctcgaccgacaaggtcgacaccgagatc
ccgtcacccgtgtccggcgtgctgctggagatcaaggccgctgaagacgagaccatcgag
gtcggcgcggccctggccgtgatcggggacgccgacgaggcagcgagcagcgacggcggc
gactccgccgctgcggcgcccgccccggcagctccggaggcggcagcgcccgacccggag
ccggcggcgacgtccgagtcccaggcgcccgcggccagcagttccgcgcccgccggcggg
gccggcaccgaggtgaccttgccggcgctcggcgagagcgtgacagaaggcaccgtgagc
cgctggctgaagcaggtcggtgacacggtcgatgccgacgaggcactgctggagatctcc
accgacaaggtcgacaccgagatcccctcgcctgtcgccggcacgatcctcgagatcagg
gtcagcgaggacgagaccgtagaggtcggcgccgtactggctgtgatcggtgatgcgtcc
caggccggggcgcccgagccggagcctgagcccgaaccggagccggaacccgagcccgag
ccggaaccagcgcccaagcccgctccggcggccgcgcggtcggccgccgagtccttgccg
ctgcagcgcgcggccgagccgccagccccggcagcaccggctccagcggccccagctccg
gcggccccagctccggcagcaccggcagccgatggggatcgcagctacgtcaccccactg
gtccgcaagctggccgctgagcacaatgtcgacctgtcgacgattcagggcaccggggtc
ggcggccgaatccgcaagcaggacgtgctggctgcggcggaagccgccaagcgggccgcg
gaggcggcagcgaaggcggaggccgcggccaaggcagcggcggcgcagccagctgcggct
ccggcggcagccccgaccgcgagcccggcaccggccaagaagccggctgccgagccgagc
ggtctgcgcggcaccaccgagaagatgtcgcggatgcgcaagacgatcgcccggcggatg
gtcgagtcgctgcagacctcggctcagctcaccgccaccgtggaggtcgacctcaccgcg
gtgtctcgcatccgtgcccaggccaaggacgccttcaaggcccgcgagggtgcgagcctg
tcgtacctgccgttcatcaccaaggccgccgtcgaggcgctcaaggtcttcccgaagctc
aacgccatcgtcgacaccgaggccggcgagatctcctacccgagcgcggagcacatcggc
atcgccgtggacaccgagcgcggtctgatggttccggtgatcaaggacgccggtgacctc
aacatcgccggcctggccaagaagatcggcgatctggcggcccggacccggaagaacaag
gtcacccccgacgagttgagcggtggcaccttcaccatcaccaactacggctcggccggg
accctgatggacaccccgatcatcaatcagccgcaggtcgccatcctgggcaccggtgcg
ctggtcaagcggccggtggtgctcaccgatccggttctcggagaggtcatcgccgtgcgg
gacatgatgtatctgtcgatgtcgtacgaccatcggatcgtcgacggcgctgatgccgct
cgcttcctgtccgcggtcaaggcccgactggaagaaggcgacttcggctccgagttcggg
gtctag

DBGET integrated database retrieval system