KEGG   Microlunatus phosphovorus: MLP_43100Help
Entry
MLP_43100         CDS       T01535                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00300  Lysine biosynthesis
mph01100  Metabolic pathways
mph01120  Microbial metabolism in diverse environments
mph01230  Biosynthesis of amino acids
Module
mph_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MLP_43100 (dapE)
Enzymes [BR:mph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MLP_43100 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAK37324
UniProt: F5XSR6
Position
complement(4618636..4619727)
Genome map
AA seq 363 aa AA seqDB search
MPEPLLETPVLDLTSDPVELLATLIDIESVSGTERRIADTVDQALRAYGHLEVIRDGNVV
IARTHLGRAGRVVIAGHLDTVPIASNVPHWREGAGADLEIWGRGACDMKGGVAVQLVCAA
ALTAPQRDLTWIFYDNEEVEAELNGLGRIGRERPELLTGDFAVLCEPTSAQIEGGCQGTM
RLACELTGRAAHSARAWMGHNAIHDAGALLHLLADHVPAQVEVDGLTYREGLNAVSISGG
IAGNVIPDRCRVEINYRFAPDKSAAEAEAYVRDVLPGFELTVTDVAIGARPGLDQPAAAE
FLAAVGAEASAKFGWTDVARFAEMGIPAVNFGPGNPSKAHADDEFCPAAEVYRCRDALLA
WLG
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccgttgctggaaaccccggtgctcgatctcacctccgatccggtcgagctg
ctggcgaccttgatcgacatcgagtcggtcagcggcaccgagcggcggatcgcggacacg
gtcgaccaggccctccgcgcgtacggccatctggaggtcatccgcgacgggaacgtggtg
atcgcccgcacccacctgggtcgggccggtcgggtggtgattgccggccacctcgacacg
gtgccgatcgcgtcgaatgtgccgcactggcgagagggtgcgggcgctgacttggagatc
tggggccgcggggcctgcgacatgaagggtggcgtcgccgttcaactggtgtgtgcggct
gccctgactgcaccgcaacgcgacctcacctggatcttctacgacaacgaggaggtcgag
gcggagctcaacggactgggccggatcggccgggagcgccctgagttgctgaccggcgat
ttcgctgtgctgtgcgagccgaccagtgcccagatcgagggtggctgccagggcacgatg
cggctggcctgcgaactgaccggccgagcagcgcactcggctcgagcctggatgggtcac
aacgcgatccacgacgcgggtgccttgctacacctgcttgccgatcacgtgccggctcag
gtcgaggtcgacggcctgacctatcgcgagggtctgaacgcggtctcgatcagcggcggc
atcgcgggcaacgtcatcccggatcgctgccgggtggagatcaactatcggttcgcgccg
gacaagtccgctgccgaagccgaggcgtacgtccgtgatgtgctgcccggtttcgagttg
acggtgaccgacgtcgcgatcggcgctcggccggggctcgaccagcccgccgcggcggag
ttcttggctgctgtcggggccgaggccagcgcgaagttcggctggaccgacgtggcccgc
ttcgccgagatgggcatcccggcggtcaacttcggtccgggaaacccgagcaaggcccac
gccgacgacgagttctgcccggcggcggaggtctaccgctgccgggacgcgctgctcgcc
tggctgggctag

DBGET integrated database retrieval system