KEGG   Microlunatus phosphovorus: MLP_45780Help
Entry
MLP_45780         CDS       T01535                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mph  Microlunatus phosphovorus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mph01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mph00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mph00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4864349..4865995)
Genome map
AA seq 548 aa AA seqDB search
MTITSEPPTRTVPNRPPAARLTVLGAHQPRFGEILTPGAVDFIAGLHHQFGSRRAELLDR
RRRRQAGDNSFDFLPETAELRADPSWQVAPPAPGLEDRRCEITGPPTRKMTIGALNSGAK
VWMADFEDATSPTWFNLIDGQLNLYDAVRRQIDFTDDSGRRHELKEQVATIMVRPRGWHL
SEEHLRMDGQPIGGAFVDFGLHFYHNALTLIASGRGPYFYLPKLESHLEARLWHDVFAWS
ERTLGIPPGTVRATCLIETFPAVFEMTEILSELRSYSAGLNAGRWDYIFSAIKSFAGDPT
MVLPDRDKITMTVPFMRSYAELLVRTCHERGAHAIGGMAAFVPSSASPEVTRRALEKTRA
DKTREARDGFDGSWVAHPGLVDTCTTVFDLELGERPHQISRRRDDVLVSAADLADLRGLP
GGVTLPGVRTNLRVSLTYLCSWVLGRGAVAIDHLMEDAATVEISRMQLWQWIRHGAYTVS
HERVTRDLVAGMLAEEAGRLRAETPDRDRWALEAARDIVAYGCLRAEFPAFLTEYGYSRY
LVHRATAA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaccagcgaaccgccgacgaggacagtgccgaaccggccaccggccgcacgg
ctcaccgtgctgggcgcgcaccagccgcgtttcggcgagatcctgaccccaggtgccgtc
gacttcatcgccgggctgcatcatcagttcggcagccgccgagccgagctgctggaccgg
agacggcgtcgacaggcgggcgacaactccttcgacttcctgccggagaccgccgagctg
cgagccgatccgtcctggcaggtggctccgccggctcccggactggaggatcggcgctgc
gagatcaccggaccaccgacgcggaagatgaccatcggcgccctgaactccggcgccaag
gtctggatggccgacttcgaggacgccacgtcgccgacctggttcaacctgatcgacggg
cagctcaacctctacgacgcggtccggcgccagatcgacttcaccgacgactcgggccga
cgccacgagctgaaggagcaggtcgcgacgatcatggtccggccgcgcggctggcatctc
agcgaggaacatctgcggatggacggccagccgatcggtggcgccttcgtcgacttcggg
ctgcacttctaccacaacgcgttgaccttgatcgccagcggacgggggccctacttctat
ctgcccaagctggaatcgcatctggaggcacggctgtggcacgacgtgttcgcctggtcc
gaacggaccctcggcatcccgccaggcaccgtccgtgccacctgcttgatcgagacgttc
ccggcggtgttcgagatgaccgagatcttgtccgagctgcgcagctactccgccgggctc
aacgccggtcgctgggactacatcttctccgcgatcaagagcttcgccggcgacccgacg
atggtgctgcccgaccgggacaagatcaccatgacggtgccgttcatgcggtcctacgcc
gaactgctggtacgcacctgccatgagcgcggcgcccacgcgatcggggggatggcggcc
ttcgtgccgagcagcgccagccctgaggtcacccgacgggccttggagaagacccgtgcg
gacaagacccgcgaagcccgcgacggattcgatggctcttgggtggcgcaccccggcctg
gtggacacctgcacgacggtgttcgatctcgagttgggcgagcgaccgcaccagatctca
cgtcgtcgtgacgatgtcctggtctctgcggccgatctcgctgatcttcggggcctgccc
ggtggggtgactctgccgggggttcgcaccaacctgcgggtcagtctgacctacctgtgt
tcctgggtgctgggccggggagcggtcgccatcgaccatctgatggaggacgcggccacg
gtcgagatctcccgaatgcaactgtggcagtggatccggcacggtgcctacaccgtctcc
catgagagggtcacccgcgacctggtggccggcatgttggccgaggaggctgggcgactg
cgtgccgaaacccctgaccgggatcggtgggcgctcgaggcggctcgcgacatcgtggcg
tacggctgcttgcgtgcggagttccccgcattcttgaccgagtacggctacagccgctac
ctcgtccatcgagccacggcagcctga

DBGET integrated database retrieval system