KEGG   Microlunatus phosphovorus: MLP_45780Help
Entry
MLP_45780         CDS       T01535                                 

Gene name
aceB
Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00620  Pyruvate metabolism
mph00630  Glyoxylate and dicarboxylate metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01120  Microbial metabolism in diverse environments
mph01200  Carbon metabolism
Module
mph_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MLP_45780 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MLP_45780 (aceB)
Enzymes [BR:mph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MLP_45780 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: BAK37592
UniProt: F5XE44
Position
complement(4864349..4865995)
Genome map
AA seq 548 aa AA seqDB search
MTITSEPPTRTVPNRPPAARLTVLGAHQPRFGEILTPGAVDFIAGLHHQFGSRRAELLDR
RRRRQAGDNSFDFLPETAELRADPSWQVAPPAPGLEDRRCEITGPPTRKMTIGALNSGAK
VWMADFEDATSPTWFNLIDGQLNLYDAVRRQIDFTDDSGRRHELKEQVATIMVRPRGWHL
SEEHLRMDGQPIGGAFVDFGLHFYHNALTLIASGRGPYFYLPKLESHLEARLWHDVFAWS
ERTLGIPPGTVRATCLIETFPAVFEMTEILSELRSYSAGLNAGRWDYIFSAIKSFAGDPT
MVLPDRDKITMTVPFMRSYAELLVRTCHERGAHAIGGMAAFVPSSASPEVTRRALEKTRA
DKTREARDGFDGSWVAHPGLVDTCTTVFDLELGERPHQISRRRDDVLVSAADLADLRGLP
GGVTLPGVRTNLRVSLTYLCSWVLGRGAVAIDHLMEDAATVEISRMQLWQWIRHGAYTVS
HERVTRDLVAGMLAEEAGRLRAETPDRDRWALEAARDIVAYGCLRAEFPAFLTEYGYSRY
LVHRATAA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaccagcgaaccgccgacgaggacagtgccgaaccggccaccggccgcacgg
ctcaccgtgctgggcgcgcaccagccgcgtttcggcgagatcctgaccccaggtgccgtc
gacttcatcgccgggctgcatcatcagttcggcagccgccgagccgagctgctggaccgg
agacggcgtcgacaggcgggcgacaactccttcgacttcctgccggagaccgccgagctg
cgagccgatccgtcctggcaggtggctccgccggctcccggactggaggatcggcgctgc
gagatcaccggaccaccgacgcggaagatgaccatcggcgccctgaactccggcgccaag
gtctggatggccgacttcgaggacgccacgtcgccgacctggttcaacctgatcgacggg
cagctcaacctctacgacgcggtccggcgccagatcgacttcaccgacgactcgggccga
cgccacgagctgaaggagcaggtcgcgacgatcatggtccggccgcgcggctggcatctc
agcgaggaacatctgcggatggacggccagccgatcggtggcgccttcgtcgacttcggg
ctgcacttctaccacaacgcgttgaccttgatcgccagcggacgggggccctacttctat
ctgcccaagctggaatcgcatctggaggcacggctgtggcacgacgtgttcgcctggtcc
gaacggaccctcggcatcccgccaggcaccgtccgtgccacctgcttgatcgagacgttc
ccggcggtgttcgagatgaccgagatcttgtccgagctgcgcagctactccgccgggctc
aacgccggtcgctgggactacatcttctccgcgatcaagagcttcgccggcgacccgacg
atggtgctgcccgaccgggacaagatcaccatgacggtgccgttcatgcggtcctacgcc
gaactgctggtacgcacctgccatgagcgcggcgcccacgcgatcggggggatggcggcc
ttcgtgccgagcagcgccagccctgaggtcacccgacgggccttggagaagacccgtgcg
gacaagacccgcgaagcccgcgacggattcgatggctcttgggtggcgcaccccggcctg
gtggacacctgcacgacggtgttcgatctcgagttgggcgagcgaccgcaccagatctca
cgtcgtcgtgacgatgtcctggtctctgcggccgatctcgctgatcttcggggcctgccc
ggtggggtgactctgccgggggttcgcaccaacctgcgggtcagtctgacctacctgtgt
tcctgggtgctgggccggggagcggtcgccatcgaccatctgatggaggacgcggccacg
gtcgagatctcccgaatgcaactgtggcagtggatccggcacggtgcctacaccgtctcc
catgagagggtcacccgcgacctggtggccggcatgttggccgaggaggctgggcgactg
cgtgccgaaacccctgaccgggatcggtgggcgctcgaggcggctcgcgacatcgtggcg
tacggctgcttgcgtgcggagttccccgcattcttgaccgagtacggctacagccgctac
ctcgtccatcgagccacggcagcctga

DBGET integrated database retrieval system