KEGG   Microlunatus phosphovorus: MLP_45780Help
Entry
MLP_45780         CDS       T01535                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mph  Microlunatus phosphovorus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_45780 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MLP_45780 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MLP_45780 (aceB)
Enzymes [BR:mph01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MLP_45780 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4864349..4865995)
Genome map
AA seq 548 aa AA seqDB search
MTITSEPPTRTVPNRPPAARLTVLGAHQPRFGEILTPGAVDFIAGLHHQFGSRRAELLDR
RRRRQAGDNSFDFLPETAELRADPSWQVAPPAPGLEDRRCEITGPPTRKMTIGALNSGAK
VWMADFEDATSPTWFNLIDGQLNLYDAVRRQIDFTDDSGRRHELKEQVATIMVRPRGWHL
SEEHLRMDGQPIGGAFVDFGLHFYHNALTLIASGRGPYFYLPKLESHLEARLWHDVFAWS
ERTLGIPPGTVRATCLIETFPAVFEMTEILSELRSYSAGLNAGRWDYIFSAIKSFAGDPT
MVLPDRDKITMTVPFMRSYAELLVRTCHERGAHAIGGMAAFVPSSASPEVTRRALEKTRA
DKTREARDGFDGSWVAHPGLVDTCTTVFDLELGERPHQISRRRDDVLVSAADLADLRGLP
GGVTLPGVRTNLRVSLTYLCSWVLGRGAVAIDHLMEDAATVEISRMQLWQWIRHGAYTVS
HERVTRDLVAGMLAEEAGRLRAETPDRDRWALEAARDIVAYGCLRAEFPAFLTEYGYSRY
LVHRATAA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaccagcgaaccgccgacgaggacagtgccgaaccggccaccggccgcacgg
ctcaccgtgctgggcgcgcaccagccgcgtttcggcgagatcctgaccccaggtgccgtc
gacttcatcgccgggctgcatcatcagttcggcagccgccgagccgagctgctggaccgg
agacggcgtcgacaggcgggcgacaactccttcgacttcctgccggagaccgccgagctg
cgagccgatccgtcctggcaggtggctccgccggctcccggactggaggatcggcgctgc
gagatcaccggaccaccgacgcggaagatgaccatcggcgccctgaactccggcgccaag
gtctggatggccgacttcgaggacgccacgtcgccgacctggttcaacctgatcgacggg
cagctcaacctctacgacgcggtccggcgccagatcgacttcaccgacgactcgggccga
cgccacgagctgaaggagcaggtcgcgacgatcatggtccggccgcgcggctggcatctc
agcgaggaacatctgcggatggacggccagccgatcggtggcgccttcgtcgacttcggg
ctgcacttctaccacaacgcgttgaccttgatcgccagcggacgggggccctacttctat
ctgcccaagctggaatcgcatctggaggcacggctgtggcacgacgtgttcgcctggtcc
gaacggaccctcggcatcccgccaggcaccgtccgtgccacctgcttgatcgagacgttc
ccggcggtgttcgagatgaccgagatcttgtccgagctgcgcagctactccgccgggctc
aacgccggtcgctgggactacatcttctccgcgatcaagagcttcgccggcgacccgacg
atggtgctgcccgaccgggacaagatcaccatgacggtgccgttcatgcggtcctacgcc
gaactgctggtacgcacctgccatgagcgcggcgcccacgcgatcggggggatggcggcc
ttcgtgccgagcagcgccagccctgaggtcacccgacgggccttggagaagacccgtgcg
gacaagacccgcgaagcccgcgacggattcgatggctcttgggtggcgcaccccggcctg
gtggacacctgcacgacggtgttcgatctcgagttgggcgagcgaccgcaccagatctca
cgtcgtcgtgacgatgtcctggtctctgcggccgatctcgctgatcttcggggcctgccc
ggtggggtgactctgccgggggttcgcaccaacctgcgggtcagtctgacctacctgtgt
tcctgggtgctgggccggggagcggtcgccatcgaccatctgatggaggacgcggccacg
gtcgagatctcccgaatgcaactgtggcagtggatccggcacggtgcctacaccgtctcc
catgagagggtcacccgcgacctggtggccggcatgttggccgaggaggctgggcgactg
cgtgccgaaacccctgaccgggatcggtgggcgctcgaggcggctcgcgacatcgtggcg
tacggctgcttgcgtgcggagttccccgcattcttgaccgagtacggctacagccgctac
ctcgtccatcgagccacggcagcctga

DBGET integrated database retrieval system