KEGG   Microlunatus phosphovorus: MLP_46010Help
Entry
MLP_46010         CDS       T01535                                 

Gene name
ugp
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mph  Microlunatus phosphovorus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MLP_46010 (ugp)
   00052 Galactose metabolism
    MLP_46010 (ugp)
   00500 Starch and sucrose metabolism
    MLP_46010 (ugp)
   00520 Amino sugar and nucleotide sugar metabolism
    MLP_46010 (ugp)
Enzymes [BR:mph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MLP_46010 (ugp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4894482..4895909)
Genome map
AA seq 475 aa AA seqDB search
MSRGHSVPQEFPRIEPMSDQGLALAQQKMIAAGVASQAIDVFSHYYRQLEQGVTGVIAED
SIEPLTDPDLLDSVAISDEDAAAALAKTVIIKLNGGLGTSMGMDKAKSLLPVRGGKSFLD
IIVEQVVSARQTYGAKLPLIFMNSFRTQDDTLAALSRYPDLEVDGLGLDFLQNSEPKLRA
DDLTPVEWPADPTLEWCPPGHGDLYTALLASGVLERLVAAGYRYASVSNSDNLGAAPNAR
IAGWFAASGAPYAAEICRRTAADRKGGHLAIRKADQQLILRDTAQTSAEEMHYFTDEFRH
PYFHTNNLWFDLELLAKTLAERNGVLGLPLIKNAKTVDPADSSSTPVIQIESAMGAAIEV
FEGATAIGVGRERFLPVKTTNDLLLLQSDVYEVGADGLLSRVADPAPLVDLDSKYYKTIG
KFAERFPAGAPSLKQATSLTVRGDWVFEDAVVVTGAVTLADPGERATVGSGTVLS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgagccggggccacagcgttccccaggagttccctaggatcgagcccatgagtgaccaa
gggctcgcgctcgcgcaacagaagatgatcgctgccggggtggcctcacaggccatcgac
gtgttcagccactactaccggcagctggagcagggcgtcaccggcgtcatcgccgaggac
tcgatcgagccgctgaccgatccggatctgctcgactcggtggcgatcagcgatgaggat
gccgcagctgccctggccaagacggtcatcatcaagctcaacggcgggttgggcacctcg
atgggcatggacaaggcgaagtcgctgctgccggttcgcggcggcaagtccttcctcgac
atcatcgtcgagcaggtggtgagcgcgcgtcagacgtacggcgcgaagctcccgctgatc
ttcatgaacagcttccggacccaggacgacacgctggcggccctaagccgctatcccgat
ctcgaggtcgacggtctcgggctggacttcctgcagaactccgagccgaagctgcgggcc
gacgacctgaccccggtcgagtggccggccgacccgacgttggagtggtgcccacctggc
cacggcgatctctacaccgcgctgctcgcctccggggtgctggagcggctggtcgcggcc
ggctatcgctatgcctcggtctcgaactccgacaacctcggcgccgcgccgaacgcacgg
atcgccgggtggttcgcggccagcggagcaccgtacgcggccgagatctgccggcgcacc
gctgccgaccgcaagggtgggcacctggcgatccgcaaggccgaccaacaactcatcctg
cgtgacaccgcgcagacgtcggcggaggagatgcactacttcaccgacgagttccggcac
ccgtacttccacaccaacaacctgtggttcgacctggagctgctcgccaagacgctcgcc
gagcgcaacggcgtcctcgggctgccgctgatcaagaacgccaagaccgtcgatccggcc
gactcgtcctcgaccccggtgatccagatcgagtcggcgatgggtgcggcgatcgaggtc
ttcgagggtgcgaccgcgatcggtgtcgggcgggagcggttcctgccggtcaagaccacc
aacgatctgctgctgctgcagtcggacgtgtacgaggtgggtgccgacggcctgctcagc
agggtcgccgacccggcccccttggtggacctggacagcaagtactacaagacgatcggc
aagttcgctgagcgtttcccggcaggggcaccctcgctcaagcaggccaccagcctgacg
gtgcggggtgactgggtcttcgaggacgccgtggtggtcaccggcgcggtgacgctggcc
gaccccggagagcgggccacggtcggatccggcacagtcctctcctga

DBGET integrated database retrieval system