KEGG   Microlunatus phosphovorus: MLP_46100Help
Entry
MLP_46100         CDS       T01535                                 

Definition
sugar kinase (EC:2.7.1.-)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_46100
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_46100
   00052 Galactose metabolism
    MLP_46100
   00500 Starch and sucrose metabolism
    MLP_46100
   00520 Amino sugar and nucleotide sugar metabolism
    MLP_46100
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MLP_46100
   00524 Butirosin and neomycin biosynthesis
    MLP_46100
Enzymes [BR:mph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MLP_46100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4902635..4903597)
Genome map
AA seq 320 aa AA seqDB search
MTVLSGRPEVVVAIDLGGTLTKIAYVTAAGDITDVQRVETRLDERGAVPPAWLAGLIKGA
ARARADLTTVGYGFVAPGIIDARVGVVRVAPNIGWRDVPIRDLLDAQTGMSGAIGHDVRA
GGLAEWRLGAHPHVDNLLFLPLGTGIAGAAVVDGRLLEAGGFAGEIGHLHVSVADQHCAC
GAYGCLETIASAAGVARSYRHTTGFRRSALEVAELARHGDQAALQAFAVAIAGLAEALAA
YAALLAPEVVIIGGGLSGAADLIMDELAEALDGRLSFHRRPQLTVASLGSDAGVRGAGLL
GWDHVRSAKSLRSTESRTDE
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgttgagtggtcgcccggaggtcgtcgtggccatcgatctcggtggcacgttg
accaagatcgcgtacgtgaccgcggccggtgacatcaccgatgtccagcgggtagagacc
aggctcgacgagcgaggcgcggtgccgccggcctggctggccggtctgatcaagggcgct
gcgcgggcacgggccgatctgacgacggtggggtacggattcgtcgcaccgggcatcatc
gacgccagggtcggggtggttcgagtggccccgaacataggctggcgtgacgtacccatc
cgggacctgctcgacgcgcaaactgggatgtccggggcaatcggtcacgacgtgcgggcg
ggtggactggccgagtggcggctgggcgcccatccgcacgtggacaacctgctgttcttg
ccgctgggcaccgggatcgccggcgcggccgtcgtcgatggccggctgctggaagcgggg
ggtttcgccggtgagatcggccatctccatgtctcggttgccgatcagcactgcgcctgc
ggcgcgtacggctgtctggagaccatcgcctcggcagctggagtggcccgcagctaccgg
cacaccaccgggttccggcgtagtgccttggaggtcgccgagcttgcccggcacggcgac
caggctgcgctgcaggcgttcgccgtggcgatcgccggactggccgaggcactggcggcg
tacgcggcgctgttggccccggaagtggtgatcatcggcggagggttgtccggcgccgct
gacctgatcatggacgagctcgccgaagccttggacggccggctgtcgttccaccgccga
ccgcagctgacggtcgccagcctcggttcggatgccggcgtacgcggtgccggcctgctc
ggctgggaccacgttcgatcagctaagagcctccgatcgactgagagcaggaccgatgag
tga

DBGET integrated database retrieval system