KEGG   Microlunatus phosphovorus: MLP_46930Help
Entry
MLP_46930         CDS       T01535                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MLP_46930 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLP_46930 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MLP_46930 (thrC)
Enzymes [BR:mph01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MLP_46930 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4998117..4999397)
Genome map
AA seq 426 aa AA seqDB search
MMTAVFSADPATGCRPGAFGNATHLICRACGAHSPLGPFYACMECFGPLEVGYAFPTITH
AEIEAGPKSIWRYAPLLPVPADISTFRSTDPGFTRLVDARQLADDIGLRQLWVKDDTGNP
THSFKDRVVAVALSAARELGLQVLACPSTGNLANAVAAAAARAGIKSVVLVPENLEKQKI
LASAVYDTTLIAVHGSYDDVNKLASEIAAEEEGWAFVNVNVRPYYAEGSKTLAFEIAEQL
GWRLPDQVVIPVASGSQLTKIDKGFAELIKLGLVEEKPYKIYGAQATGCSPVAHAYREGW
DIVQPVKPNTIAKSLAIGNPADGPYVLDVVRRTGGAIADIDDDTVVANIQRLARTEGIFA
ETAGGVTVGVTAKLVADGLLDPDQETVLINSGDGLKTLDAVADRVGPKTTIPPRYEAFTE
FWKARG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgcggtcttctcggccgaccccgccaccggctgtcgtcctggtgctttcggc
aacgctacccacctgatctgtcgcgcctgtggtgcacatagcccgctcggcccgttctat
gcctgcatggagtgtttcggcccgctcgaggtcggctacgccttcccgaccatcacccat
gccgagatcgaggccgggcccaagtcgatctggcggtacgcgccgctgctcccggtgccg
gccgacatttcaaccttccgctccaccgacccgggcttcaccaggctggtcgatgctcgg
cagttggccgacgacatcggcttgcgtcagctgtgggtcaaggacgacaccggcaacccg
acccactcgttcaaggatcgggtcgtcgccgtcgcattgtcggcggcccgcgagctcggc
ctgcaggtgctggcctgtccctccacgggaaacctcgccaacgccgtcgccgcggcagct
gcccgggcgggtatcaagagtgtggttctggtgccggagaacctcgagaagcagaagatc
ctcgcctcggctgtctacgacaccacgctgatcgccgtccacggcagctacgacgacgtg
aacaagctggccagcgagatcgccgccgaggaggagggctgggcattcgtcaacgtcaac
gtccgcccctactacgccgagggctccaagaccttggcgttcgagatcgccgagcagctc
ggctggcggctgcccgaccaggtggtgatcccagttgcctccggttctcagctgaccaag
atcgacaagggcttcgcggagttgatcaagctcgggctggtcgaggagaagccgtacaag
atctacggcgctcaggccaccggctgttccccggtcgcccatgcctatcgcgagggctgg
gacatcgtgcagccggtcaagcccaacacgatcgccaagtcgctggccatcggcaacccg
gccgacggaccgtacgtgctggatgtcgtccgccgcaccggtggtgcgatcgccgacatc
gatgacgacaccgtcgtagccaacattcagcggctcgcccggaccgagggcatcttcgcc
gagaccgccggcggagtgactgttggtgtcaccgccaagctggttgccgacgggttgctc
gatccggaccaggagacggtgctgatcaactccggcgacggtttgaagaccctcgatgca
gtggccgatagagtcggtccgaagaccacgatcccgcctcgctacgaggcgttcaccgaa
ttctggaaggcacgaggctga

DBGET integrated database retrieval system