KEGG   Microlunatus phosphovorus: MLP_47390Help
Entry
MLP_47390         CDS       T01535                                 

Gene name
gpm
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00010  Glycolysis / Gluconeogenesis
mph00260  Glycine, serine and threonine metabolism
mph00680  Methane metabolism
mph01100  Metabolic pathways
mph01110  Biosynthesis of secondary metabolites
mph01120  Microbial metabolism in diverse environments
mph01130  Biosynthesis of antibiotics
mph01200  Carbon metabolism
mph01230  Biosynthesis of amino acids
Module
mph_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_47390 (gpm)
  Energy metabolism
   00680 Methane metabolism
    MLP_47390 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLP_47390 (gpm)
Enzymes [BR:mph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MLP_47390 (gpm)
Membrane trafficking [BR:mph04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    MLP_47390 (gpm)
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MLP_47390 (gpm)
  Exosomal proteins of melanoma cells
   MLP_47390 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAK37753
UniProt: F5XF15
Position
complement(5042952..5043692)
Genome map
AA seq 246 aa AA seqDB search
MILLRHGESEWNATNQFTGWVDVDLTAKGEAEAKHGGELLVENDLLPDVLHTSLLKRAIR
TSQISLEVADRHWIPTKRHWRLNERHYGALQGKDKAATLAEFGEEQFMLWRRSYDTPPPA
IDNDSEFSNFHDPRYAGMPPELRPQTECLKDVLERALPYWYDEIVPDLAAGKVVLVVAHG
NSLRAIVKHLDKMGDAEVVGLNIPTGIPLLYELNDDFTPVTVGGRYLDPNAAAAAIEAVK
NQGKKK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctgcttcgccacggcgagagcgaatggaacgccaccaaccagttcaccggctgg
gtggacgtcgacctcaccgcgaagggcgaggccgaggccaagcatggcggtgagctgctg
gtcgagaacgacctgctccccgacgtgctgcacacctcgctgctcaagcgcgccatccgt
acctcccagatctctctcgaggtcgccgaccggcactggatcccgaccaagcggcactgg
cggctgaacgagcggcattacggtgcgctgcagggcaaggacaaggccgcgacgcttgcc
gagttcggtgaggagcagttcatgctctggcgccgctcgtacgacaccccgccgcccgct
atcgacaacgacagcgagttctccaactttcacgacccgcggtacgccggcatgccgccg
gagctgcggccacagaccgagtgcctgaaggacgtgctggagcgggcgctgccgtactgg
tacgacgagatcgtcccggacctggccgccggcaaggtcgtgttggtcgtggcgcacggc
aactcgctccgggcgatcgtcaagcacctcgacaagatgggcgacgccgaggtcgtcggg
ctcaacatccccaccggcatcccgctgctctacgagctgaacgacgacttcaccccggtc
accgtcggtgggcgttacctcgacccgaacgccgccgcagcggctatcgaagcggtcaag
aaccaaggtaagaagaagtag

DBGET integrated database retrieval system