KEGG   Microlunatus phosphovorus: MLP_47390Help
Entry
MLP_47390         CDS       T01535                                 

Gene name
gpm
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mph  Microlunatus phosphovorus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MLP_47390 (gpm)
   01230 Biosynthesis of amino acids
    MLP_47390 (gpm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MLP_47390 (gpm)
  Energy metabolism
   00680 Methane metabolism
    MLP_47390 (gpm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MLP_47390 (gpm)
Enzymes [BR:mph01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MLP_47390 (gpm)
Exosome [BR:mph04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MLP_47390 (gpm)
  Exosomal proteins of melanoma cells
   MLP_47390 (gpm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5042952..5043692)
Genome map
AA seq 246 aa AA seqDB search
MILLRHGESEWNATNQFTGWVDVDLTAKGEAEAKHGGELLVENDLLPDVLHTSLLKRAIR
TSQISLEVADRHWIPTKRHWRLNERHYGALQGKDKAATLAEFGEEQFMLWRRSYDTPPPA
IDNDSEFSNFHDPRYAGMPPELRPQTECLKDVLERALPYWYDEIVPDLAAGKVVLVVAHG
NSLRAIVKHLDKMGDAEVVGLNIPTGIPLLYELNDDFTPVTVGGRYLDPNAAAAAIEAVK
NQGKKK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctgcttcgccacggcgagagcgaatggaacgccaccaaccagttcaccggctgg
gtggacgtcgacctcaccgcgaagggcgaggccgaggccaagcatggcggtgagctgctg
gtcgagaacgacctgctccccgacgtgctgcacacctcgctgctcaagcgcgccatccgt
acctcccagatctctctcgaggtcgccgaccggcactggatcccgaccaagcggcactgg
cggctgaacgagcggcattacggtgcgctgcagggcaaggacaaggccgcgacgcttgcc
gagttcggtgaggagcagttcatgctctggcgccgctcgtacgacaccccgccgcccgct
atcgacaacgacagcgagttctccaactttcacgacccgcggtacgccggcatgccgccg
gagctgcggccacagaccgagtgcctgaaggacgtgctggagcgggcgctgccgtactgg
tacgacgagatcgtcccggacctggccgccggcaaggtcgtgttggtcgtggcgcacggc
aactcgctccgggcgatcgtcaagcacctcgacaagatgggcgacgccgaggtcgtcggg
ctcaacatccccaccggcatcccgctgctctacgagctgaacgacgacttcaccccggtc
accgtcggtgggcgttacctcgacccgaacgccgccgcagcggctatcgaagcggtcaag
aaccaaggtaagaagaagtag

DBGET integrated database retrieval system