KEGG   Microlunatus phosphovorus: MLP_47790Help
Entry
MLP_47790         CDS       T01535                                 

Definition
glycosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mph  Microlunatus phosphovorus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mph00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mph00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5080897..5082213)
Genome map
AA seq 438 aa AA seqDB search
MRRRGLAGVVIGVVCGLTLVACGNSPGAVPSPGAASTSGTAETPSQVASGLPSTSASPGA
PANPTSTSTATSTSTVKPTTMPTPSSTQSENPTAQCKALAASLSLRDQVGQLLMVAVPST
GVGSSAAKAVHDSRTGAVILLGNTTAGQSRILAVTKQARDAARTPKGIKILLAADQEGGM
VQRLQGKGFDRIPSAQEQAQESAAELRRDATRWGKQLGRAGINANLAPVADVVPKDMQSV
NQPIGLLRRGYGSNPTKVAAHVAAFVEGMDAAGIATSVKHFPGLGRVRGNTDFVARVVDD
TTTRHDKALKPFAAGVDAGTDMVMVSSAYYSEIDAKRRAAFSPIVVKGMIRDDLGFEGVV
ISDDLAAAAMRDLAPGTRLLRFLKAGGDLAIVGDPSIVASMADAVVAEAKKDDALAAAIE
TAAARVLQLKDRRGLASC
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgtcgagggctggcgggtgtcgtgatcggagttgtctgcggtctgaccctggtg
gcctgcggcaacagtcctggtgccgtgccgagtccaggagcggcatcgacctcagggacc
gccgagacgccgagccaggtggcctcggggctaccatcgacctcagccagccccggtgcg
ccggccaaccccacctcgaccagcacggcaacctcgaccagcaccgtgaaaccgaccact
atgcccacgcccagcagtacgcagagtgagaatccgacggcccagtgcaaggccttggcc
gcctcgctcagcctgcgcgatcaggtcggccagttgctgatggtcgccgtgccctcgacc
ggggtcggatcctccgcggccaaggcggtccacgacagtcgcaccggggcagtcatcctg
ctcggcaacaccaccgcgggacagagccggatcctcgccgtgaccaagcaggctcgggat
gcggcgcggacgcccaaggggatcaagatcttgctggccgccgaccaggagggcggcatg
gtgcaacgactgcaaggcaaaggcttcgaccgcattccctctgcccaggaacaggcccag
gagtcggcagccgagctgaggcgcgatgcaactcgctggggtaagcagctcgggcgggcc
ggcatcaatgccaacctggctccggtcgccgatgtcgtacccaaggacatgcagagcgtc
aaccagccgatcggtctactgcgccgtggctatggctcgaatccgaccaaggtcgccgct
catgtagccgccttcgtcgagggcatggacgcggcggggatcgctacctcggtcaagcac
ttcccgggcctcggtcgggtccgcggcaacaccgatttcgtcgcccgggtggtcgacgac
acgacgactcggcacgacaaggcgctgaagcccttcgcggcgggggtcgacgccggtacg
gacatggtgatggtgtcgtcggcctactacagcgagatcgatgccaagcggcgcgcggcg
ttctcgccgatcgtggtcaagggcatgatccgcgacgatctggggttcgagggcgtggtc
atctccgacgatctggcagccgcggcgatgcgggacctggcgcccggaacccggctgctg
cgcttcctgaaggccggtggcgacctcgcgatcgtgggtgatccgagcatcgtcgcgtcg
atggcggacgcggtggtcgccgaggcgaagaaggacgatgcgttggctgccgcgatcgag
accgccgcagcccgggtgctgcaactcaaggaccggcgcggcctggcctcctgctag

DBGET integrated database retrieval system