KEGG   Microlunatus phosphovorus: MLP_48430Help
Entry
MLP_48430         CDS       T01535                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mph  Microlunatus phosphovorus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MLP_48430 (folK)
Enzymes [BR:mph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MLP_48430 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5144230..5144793)
Genome map
AA seq 187 aa AA seqDB search
MSSPNPYAIDADTLSGMKPLRKVVYSLGSNLGDRLNNLQGAVDAIRDTPDVIVVDVSSVY
ETEPVGGPADSPSFLNLVVVAESTLEPRTLLERAQAIEDAFGREREEKWAPRTLDVDLIM
VGNSTAETDDMRLPHPLAGERAFVLLPWLEVDARGEIPGVGRISELAAAVSGTDGVVRRT
DLEIEVD
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtcccaatccctatgccattgacgcggacaccctgagcggaatgaagccgctc
cgtaaagtcgtctactcgcttggctccaatctcggcgaccggctgaacaacctgcagggc
gcggtcgatgccattcgggacaccccggatgtgatcgtggtcgatgtctcctcggtgtac
gagaccgagccggtgggcggtccggcggacagcccgtctttcctgaacctggtggtggtg
gccgagtcgaccctggaaccgcggaccttgctggagcgtgcccaggcgatcgaggacgcg
ttcggccgggagcgggaggagaagtgggccccccgaaccctcgatgtggacctgatcatg
gtcggcaactcgaccgccgagaccgacgacatgcgcctgccgcatccgctggccggcgag
cgtgccttcgtgctgctgccctggttggaggtcgatgcccgcggtgaaatccccggtgtc
ggtcggatctctgaactggccgccgctgtttcgggcaccgatggtgtcgtacggcgcacc
gatctcgagatcgaagtcgactga

DBGET integrated database retrieval system