KEGG   Microlunatus phosphovorus: MLP_48650Help
Entry
MLP_48650         CDS       T01535                                 

Definition
(GenBank) hypothetical protein
  KO
K00441  coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
mph  Microlunatus phosphovorus
Pathway
mph00680  Methane metabolism
mph01100  Metabolic pathways
mph01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mph00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MLP_48650
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.98  With other, known, physiological acceptors
    1.12.98.1  coenzyme F420 hydrogenase
     MLP_48650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FrhB_FdhB_C FrhB_FdhB_N Fer4_13 Fer4_15
Motif
Other DBs
NCBI-ProteinID: BAK37879
UniProt: F5XFE1
Position
complement(5165816..5167075)
Genome map
AA seq 419 aa AA seqDB search
MNSKPSGLDTIRDVVDAHLCCGCGACAYLEPDQFRMDEVPGVGRRPLQIVGVTGGPTPEA
VAACPGRRLAHPPEVLVDSPFGGAWGPVLGVYECWATDDELRYRGSSGGVISALAVHALE
SGSAVGTLGVRARRDAPLLNETVLNRSREDVLNSAGSRYAPASPCQRLDLVENAEGPCVV
VGKPCDIAATRSAATLRPALGDKVALTIGIFCAGTPSTQATEQVIASLGLDPASTVRVDY
RGEGWPGSFRVETSDGRRGETTYAEAWGGTLAKHRQWRCQICPDHTGEFADLSVGDPWYR
EVAEDEPGRSLVVVRTSRGQAALDRALRDGALQGGPIATQYLPEAQPHLQMARGAVWARV
LTMRLAGLRTPLYENLPSARLWWALSFKRKRSSVLGTVRRIVSRGLRRPEPGRGDLEQP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcgaagccttcgggtcttgatacgatccgggatgttgtagatgcgcatttgtgt
tgcggatgcggagcctgcgcatatctagagccggaccaatttcgtatggacgaggtccct
ggtgtgggccgacgccctcttcagatcgtcggagtaaccgggggcccaacacccgaagcg
gtggcggcttgcccgggacggaggctcgcccacccaccagaagtcttggttgattccccc
ttcggaggcgcatgggggccggtgttgggcgtatatgaatgttgggccacggatgatgag
ttgcgatatcgaggatcctctgggggagtgatcagtgctcttgctgtccacgcactcgaa
tctggctccgctgtcgggacgctgggcgtgagggctcgccgagacgccccgcttctaaat
gagacagttctgaatcgatctcgcgaagatgtcttgaactcggctggatccagatatgcg
ccggcgagcccttgccagcgattggatcttgtggagaacgctgaagggccatgcgtcgtt
gttgggaaaccgtgcgacattgccgcaacccgatcggcggccactctccggccggcgctg
ggggacaaggtcgcgttgactattggcatcttctgcgcggggactccttcaacccaggcc
accgaacaggtcattgcatccctaggactcgatccagccagcaccgtgcgcgtggactac
cgaggagagggttggcctggcagttttcgagtcgaaacgagcgatggacgtcgtggtgag
actacctatgctgaggcgtggggcgggacgttggcgaagcaccgtcagtggcgctgccag
atctgtcccgaccacaccggagagttcgccgacctatcggtcggtgacccctggtaccgc
gaggtcgccgaggacgagccaggccgatcgctagtcgttgtccgtacctctaggggccaa
gcggcgcttgatcgggcactacgtgatggagcattgcagggcggtccgatcgccacccag
tacctaccagaagctcagccccacctgcagatggcccgtggcgccgtatgggcgcgtgtc
ctcaccatgcgactggccgggttacggaccccgttgtacgagaacctgccgtcggcacgg
ttgtggtgggcgctgtcgttcaagcgtaagcgcagttccgtgctggggacggtgcggcga
atcgtcagcaggggcttgcgtcgtccggagcccggacgaggggaccttgaacagccctga

DBGET integrated database retrieval system