KEGG   Microlunatus phosphovorus: MLP_48650Help
Entry
MLP_48650         CDS       T01535                                 

Definition
hypothetical protein
Orthology
K00441  
coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
mph  Microlunatus phosphovorus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mph00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5165816..5167075)
Genome map
AA seq 419 aa AA seqDB search
MNSKPSGLDTIRDVVDAHLCCGCGACAYLEPDQFRMDEVPGVGRRPLQIVGVTGGPTPEA
VAACPGRRLAHPPEVLVDSPFGGAWGPVLGVYECWATDDELRYRGSSGGVISALAVHALE
SGSAVGTLGVRARRDAPLLNETVLNRSREDVLNSAGSRYAPASPCQRLDLVENAEGPCVV
VGKPCDIAATRSAATLRPALGDKVALTIGIFCAGTPSTQATEQVIASLGLDPASTVRVDY
RGEGWPGSFRVETSDGRRGETTYAEAWGGTLAKHRQWRCQICPDHTGEFADLSVGDPWYR
EVAEDEPGRSLVVVRTSRGQAALDRALRDGALQGGPIATQYLPEAQPHLQMARGAVWARV
LTMRLAGLRTPLYENLPSARLWWALSFKRKRSSVLGTVRRIVSRGLRRPEPGRGDLEQP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcgaagccttcgggtcttgatacgatccgggatgttgtagatgcgcatttgtgt
tgcggatgcggagcctgcgcatatctagagccggaccaatttcgtatggacgaggtccct
ggtgtgggccgacgccctcttcagatcgtcggagtaaccgggggcccaacacccgaagcg
gtggcggcttgcccgggacggaggctcgcccacccaccagaagtcttggttgattccccc
ttcggaggcgcatgggggccggtgttgggcgtatatgaatgttgggccacggatgatgag
ttgcgatatcgaggatcctctgggggagtgatcagtgctcttgctgtccacgcactcgaa
tctggctccgctgtcgggacgctgggcgtgagggctcgccgagacgccccgcttctaaat
gagacagttctgaatcgatctcgcgaagatgtcttgaactcggctggatccagatatgcg
ccggcgagcccttgccagcgattggatcttgtggagaacgctgaagggccatgcgtcgtt
gttgggaaaccgtgcgacattgccgcaacccgatcggcggccactctccggccggcgctg
ggggacaaggtcgcgttgactattggcatcttctgcgcggggactccttcaacccaggcc
accgaacaggtcattgcatccctaggactcgatccagccagcaccgtgcgcgtggactac
cgaggagagggttggcctggcagttttcgagtcgaaacgagcgatggacgtcgtggtgag
actacctatgctgaggcgtggggcgggacgttggcgaagcaccgtcagtggcgctgccag
atctgtcccgaccacaccggagagttcgccgacctatcggtcggtgacccctggtaccgc
gaggtcgccgaggacgagccaggccgatcgctagtcgttgtccgtacctctaggggccaa
gcggcgcttgatcgggcactacgtgatggagcattgcagggcggtccgatcgccacccag
tacctaccagaagctcagccccacctgcagatggcccgtggcgccgtatgggcgcgtgtc
ctcaccatgcgactggccgggttacggaccccgttgtacgagaacctgccgtcggcacgg
ttgtggtgggcgctgtcgttcaagcgtaagcgcagttccgtgctggggacggtgcggcga
atcgtcagcaggggcttgcgtcgtccggagcccggacgaggggaccttgaacagccctga

DBGET integrated database retrieval system