KEGG   Microlunatus phosphovorus: MLP_51390Help
Entry
MLP_51390         CDS       T01535                                 

Definition
DNA glycosylase (EC:3.2.2.-)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mph  Microlunatus phosphovorus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mph03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5468384..5469247)
Genome map
AA seq 287 aa AA seqDB search
MPEMPEVDSLRVFLTDKLVGRTITRIDVVAFSALKTYDPPPSALYGLEISGVARHGKFLD
IDAQGLHLVFHLARAGWLRWKEQQPTVPPKAGRGPLAVRVHLDDGTGFDLTEAGTQRKLA
VYVVDDPGLIPHVATLGPDPLADGFDKAALSALLHKAGRAQLKGVLKDQRVIAGIGNAYS
DEILHAARMSPFKPASSLTDQELTTLYDAIQSELRGAIQRAEGLAAKDLKGEKKSGLRVH
GRKGEKCPVCGDTIAEVSFSDSSLQYCPTCQTGGKKLADRRMSRLLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccggagatgccagaggtcgactcgctccgcgtctttctcaccgacaaactggtcggg
cggacgatcacccggatcgacgtggtggcgttcagtgcgctgaagacctatgacccgccg
ccgtcggcgctctacgggctggagatctcgggggtggcgcggcatggcaagttcctcgac
atcgatgcccagggactgcacctggtcttccacctggcccgggcgggttggctgcgctgg
aaagagcagcaaccgaccgtgccgcccaaggcaggtcgcggtccgctggcggtgcgcgtc
cacctggacgacggcaccgggttcgatctgaccgaggcgggtacgcagcgcaagctggcc
gtctatgtcgtggacgacccgggactgatcccgcacgttgccacgctcggcccggatccg
ttggccgatggcttcgacaaggcagccctcagcgcactgctccacaaggcggggcgcgcg
cagctcaagggggtgctcaaggaccaacgggtcatcgccggcatcggcaatgcctattcc
gacgagatcctgcatgcggcccgaatgagcccgttcaagcctgcctcgtcgctcaccgac
caggagttgacgacgctctatgacgctatccagtccgagctgcgcggtgcgatccagcgt
gcagaaggacttgcggccaaggatctgaagggggagaagaaatccgggctgcgcgtgcac
ggccgcaagggcgagaagtgcccggtgtgcggggacaccatcgcggaggtctccttctcg
gactcgtcgttgcagtactgcccgacctgccagaccggcggaaagaagcttgccgatcgc
cgaatgtctcgcctgctcaagtag

DBGET integrated database retrieval system