KEGG   Mycobacterium phlei: MPHLCCUG_00864Help
Entry
MPHLCCUG_00864    CDS       T04305                                 

Gene name
pcaF_2
Definition
(GenBank) Beta-ketoadipyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mphl  Mycobacterium phlei
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mphl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MPHLCCUG_00864 (pcaF_2)
   00630 Glyoxylate and dicarboxylate metabolism
    MPHLCCUG_00864 (pcaF_2)
   00640 Propanoate metabolism
    MPHLCCUG_00864 (pcaF_2)
   00650 Butanoate metabolism
    MPHLCCUG_00864 (pcaF_2)
  Lipid metabolism
   00071 Fatty acid degradation
    MPHLCCUG_00864 (pcaF_2)
   00072 Synthesis and degradation of ketone bodies
    MPHLCCUG_00864 (pcaF_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MPHLCCUG_00864 (pcaF_2)
   00310 Lysine degradation
    MPHLCCUG_00864 (pcaF_2)
   00380 Tryptophan metabolism
    MPHLCCUG_00864 (pcaF_2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MPHLCCUG_00864 (pcaF_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MPHLCCUG_00864 (pcaF_2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MPHLCCUG_00864 (pcaF_2)
Enzymes [BR:mphl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MPHLCCUG_00864 (pcaF_2)
Exosome [BR:mphl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MPHLCCUG_00864 (pcaF_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(843794..845002)
Genome map
AA seq 402 aa AA seqDB search
MANVWILGGYQSDFSRNITREGRDFADLTAEVVDRTLAAAKVDADDIEVIHVGNAFGELF
GGQGHLGAMPATVHDALWDKPAARHEAACASGSIAVLSALADLRSGNYRTALVLGVELER
TVPGDVGAAHLGTAAWIGHEGQGVTHMWPYMFSQVLDAYDARYGVDPAHLSAIAQLNFAN
ARNNPNAQTRGWTVPEPITADDVNNPVVAGRMRRFDCSQMTDGGAGVVLVTDDYLRHHPT
ARPLARIAGWGHRTVGLGLRQKLDRDADNPYLLPHVRGAVLDAFTRAGVGLDSLDGFEVH
DCFTPSEYVAIDHIGLTDPGESWKAVESGDIEIGGRLPINPSGGLIGGGHPVGATGVRML
LDAAKQVSGTAGDYQVEGAKTFGTLNFGGSTATTVSFVVGKD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgtctggatcctcggcggctaccagagcgacttctcccgcaacatcacccgg
gagggccgcgacttcgcggacctgaccgccgaggtggtcgaccgcaccctggccgccgcc
aaggtggacgccgacgacatcgaggtcatccacgtcggcaacgcgttcggggaactgttc
ggcgggcagggccatctcggcgcgatgccggccaccgtgcacgacgccctgtgggacaaa
cccgcggcccgccacgaggccgcgtgcgcgtccggcagcatcgcggtgctctcggcgctg
gccgatctgcgctccggcaactaccgcaccgcgctggtgctcggcgtcgaactggagcgc
accgtgcccggcgacgtcggcgccgcccacctgggcaccgccgcgtggatcggccacgag
ggccagggcgtcacccacatgtggccctacatgttctcccaggtgctcgacgcctacgac
gcgcgctacggcgtcgaccccgcccacctgagcgccatcgcgcagctcaacttcgccaac
gcccgaaacaaccccaacgcccagacccgcggctggacggtgcccgagccgatcaccgcc
gacgacgtgaacaaccccgtcgtcgcgggccggatgcgccgcttcgactgcagccagatg
accgacggcggcgccggcgtcgtgctggtcaccgacgactacctgcgccaccacccgacc
gcgcggccgctggcccgcatcgccgggtggggccaccgcaccgtcgggctcggcctgcgg
cagaagctggaccgcgacgccgacaacccgtacctgctgccgcatgtgcgcggcgccgtg
ctcgacgcgttcacccgcgccggggtgggcctcgacagcctcgacggcttcgaggtgcac
gactgcttcacccccagtgagtacgtcgcgatcgaccacatcggcctgaccgacccgggt
gagtcctggaaggcggtcgagagcggcgacatcgagatcggcgggcggctgccgatcaac
cccagcggcggcctgatcggcggcggccatcccgtcggcgccaccggggtgcgcatgctg
ctcgacgccgccaaacaggtcagcggaaccgcaggcgactaccaggtcgagggcgcgaag
acgttcggcaccttgaacttcggcggcagcaccgccaccactgtcagcttcgttgtcgga
aaggactga

DBGET integrated database retrieval system