KEGG   Mycobacterium phlei: MPHLCCUG_01888Help
Entry
MPHLCCUG_01888    CDS       T04305                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mphl  Mycobacterium phlei
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mphl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MPHLCCUG_01888 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    MPHLCCUG_01888 (thlA)
   00640 Propanoate metabolism
    MPHLCCUG_01888 (thlA)
   00650 Butanoate metabolism
    MPHLCCUG_01888 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    MPHLCCUG_01888 (thlA)
   00072 Synthesis and degradation of ketone bodies
    MPHLCCUG_01888 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MPHLCCUG_01888 (thlA)
   00310 Lysine degradation
    MPHLCCUG_01888 (thlA)
   00380 Tryptophan metabolism
    MPHLCCUG_01888 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MPHLCCUG_01888 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MPHLCCUG_01888 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MPHLCCUG_01888 (thlA)
Enzymes [BR:mphl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MPHLCCUG_01888 (thlA)
Exosome [BR:mphl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MPHLCCUG_01888 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1946983..1948989
Genome map
AA seq 668 aa AA seqDB search
MSLLTGQTAVITGGAQGLGYAIAERFVAEGARVVLGDLNLEATQAAAEKLGGDDVAVAVQ
CDVTKLADVEALVGTAVDRFGGLDIMVNNAGITRDATLRKMTEEQFDQVIAVHLRGTWNG
LKAAAPIMREQKRGAIVNMSSISGKVGMIGQTNYSAAKAGIVGMTKAASKELAYLGVRVN
AIQPGLIRSAMTEAMPKKAWDEKLAEVPMGRAGEPEEVAKVALFLASDMSSYMTGTVLEV
TGVGTCEDRPSEDRSAARGKPSMTTRTAVICEPVRTPIGRYGGMFKSLTAVDLGVTALKG
LLERTGIAPDAVQDVILGHCYPNSEAPAIGRVVALDAGLPITVPGMQVDRRCGSGLQAVI
QACLQVASGDNDLVVAGGTESMSNVVFYSTDMRWGGARTGVRIHDGLARGRTTAGGRHYP
VPGGMLETAENLRRQYGISRQEQDELAVTSHQRAVAAQRNGILAEEIVPVTVRTRQGEEV
IDTDEHPRADTTVEALAKLKPVLLKEDPEATVTAGNSSGQNDAASMCIVTTPEKAAELGL
TPLVRLVSWGSAGVAPNIMGIGPVPATEVALAKAGLTLADIDLIELNEAFAAQALAVMRE
WNFGAADLERTNVHGSGISLGHPVGATGGRMLATLARELNRREARYGLETMCIGGGQGLA
AVFERVAA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgctgttgaccggacagaccgcagtcatcaccggaggcgcgcagggcctcgggtac
gcgatcgccgagcggttcgtcgccgagggggcacgagtggtgctgggcgacctgaatctg
gaggctacccaggcggcggccgagaagctcggcggcgacgacgtcgccgtggcggtgcag
tgtgacgtcaccaagctcgccgacgtggaggcgctggtgggcaccgcggtggaccggttc
ggcgggctggacatcatggtcaacaacgcaggcatcacccgcgacgccacgctgcgcaag
atgaccgaggagcagttcgaccaggtcatcgccgtgcacctgcgcggcacctggaacggg
ctgaaggcggcggcgccgatcatgcgcgaacagaagcgcggcgcgatcgtgaacatgtcg
tcgatctccggcaaggtcggcatgatcggccagaccaactactcggcggccaaggccggc
atcgtcggcatgaccaaggccgcgtcgaaggagctcgcctatctcggcgtgcgggtcaac
gcgattcagccggggctgatccgctcggcgatgaccgaggccatgccgaagaaggcgtgg
gacgagaagctggcggaggtgccgatgggccgcgccggtgagccggaggaggtcgccaag
gtggcgctgttcctggccagcgacatgtcgtcgtacatgaccggcaccgttctggaggtg
accggggtcggcacctgtgaggaccgcccgagcgaggatcgcagcgcagcgagggggaag
ccgagcatgacgacccgcaccgccgtcatctgtgagcccgttcggaccccgatcggccgc
tacgggggcatgttcaagagcctcacggccgtcgacctcggcgtgaccgcgctcaagggg
ttgttggagcgcaccggaatcgcccccgacgcggtgcaggacgtgatcctcgggcactgc
tacccgaacagcgaggcgcccgcgatcggccgtgtggtggcgctggacgccgggctgccg
atcaccgtgcccggtatgcaggtcgaccgtcgctgcggctccggtttgcaggccgtcatc
caggcgtgcctgcaggtggccagcggcgacaacgatctggtggtcgcgggcggcaccgag
agcatgagcaacgtcgtgttctactcgaccgacatgcggtggggcggggcgcgcaccggc
gtgcggatccacgatgggctggcgcggggccgcaccaccgcgggcgggcggcactacccg
gtgcccggcggcatgctcgagaccgccgagaacctgcgccgccagtacggaatctcgcgc
caggagcaggacgagctcgcggtgacgtcgcaccagcgggcggtggccgcgcagcgcaac
gggatcctggccgaggagatcgtgccggtcaccgtgcgcacccgtcagggcgaggaggtg
atcgacaccgacgaacacccgcgggccgacaccaccgtcgaggcgctggcgaagctgaaa
cccgttctgctgaaggaggatccggaggcaacggtgaccgcgggcaactccagcgggcag
aacgacgccgcgtcgatgtgcatcgtcaccaccccggagaaggccgccgaactggggctg
acgccgctggtgcggttggtgtcgtggggttcggccggggtggcgcccaacatcatgggc
atcgggccggtgccggcgaccgaggtggcgctcgccaaggccggactgacactggccgac
atcgacctgatcgagctcaacgaggcgttcgccgcgcaggcgcttgcggtgatgcgggag
tggaacttcggcgccgccgatctcgaacgcaccaacgtgcacggctccggcatctcgctg
ggccatccggtcggtgccaccggcgggcgcatgctggccaccctggcgcgcgagctcaac
cggcgcgaggcccgctacggcctggagaccatgtgcatcggtggcggccagggtctggcc
gccgtgttcgagagggtggcagcctga

DBGET integrated database retrieval system