KEGG   Methanoplanus petrolearius: Mpet_0083Help
Entry
Mpet_0083         CDS       T01312                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mpi  Methanoplanus petrolearius
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mpi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96766..98571)
Genome map
AA seq 601 aa AA seqDB search
MCGIAGLFNISGKPADEKCLRSMSEVLTHRGPDDSGFFIEDEIGLAHRRLSIIDLSKEGR
QPMTNEDDSLWLIFNGEIYNYPDIKTELTSLGHIFKSETDSEVIIHSYEEWGPDCLSKFN
GMWAFAIWDGNKKELFCARDRLGIKPFYYAIKDDNFIFASEIKALRCYQGVGKEPNEKQL
INFLKWGLSDHTNETMFDGIFQLPAGHYMQIRAGCQPEAFCYWHTEKSNEIISDHKTDTE
DSKQLLELLKDSVKIHLRSDVPTGTCLSGGLDSSTITALINRLLKENCPGAPKQKTFSAV
FEEKKFDESEYVKIVTDFLKVDAYYTRPNPEDLWEDLGHLIYSNDEPFMQLTLYSQYCVM
RDLSKQVKVVLDGQGADEIFAGYLAYIYCHISSLLHGKHFLTAASESLGVLRRHSGFLFY
AVRQYFVRKQRRDLIKGFEEPLVRYQGNLNESLMTDLTSTNLPYLLHWEDRVSMAFSVEA
RVPFLDYRVVNFANSLPADKKIRKGVTKFIFRKSIKDLVPESIRCRMDKKGFSTPEEVWM
QGSLKDHILEVLGSESFSSRKYWDSKMVTADYNDFIAGKKQYSSEIWRIVCTELWLRIFF
P
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaattgcaggactattcaatatttcaggaaaaccggccgatgaaaaatgcctg
agatcgatgtcggaagttcttacgcacaggggccctgacgattccggcttttttattgaa
gatgagataggccttgcccaccgccgtctttccattatcgatctgtcaaaagaaggcaga
cagccaatgacaaacgaggatgattccctctggctgatattcaatggagaaatctataat
tatccggatataaagacagaattgaccagccttggacacattttcaaatcagaaactgat
agcgaggtcatcattcatagttatgaggaatgggggcccgactgcctttcaaagtttaac
ggcatgtgggcgtttgccatttgggacggaaataaaaaggaactcttctgcgcacgcgac
aggttagggattaagccattttattatgcgataaaggatgacaacttcatttttgcatct
gaaataaaggctttgcgctgctaccagggtgtaggcaaagaaccgaacgaaaaacagctt
ataaatttcctgaaatggggcctttcggatcacaccaacgaaacgatgtttgatgggatt
tttcagctccctgcaggccattatatgcagatccgggcaggttgccagcccgaagcattc
tgttactggcacacggaaaagagcaatgaaataatatccgatcacaagaccgacacggaa
gattcaaaacagcttttggaactcctgaaagattctgtgaagatacatcttcgaagcgat
gtccctaccggcacatgtctcagcggcggtctggattcgtccacgatcactgccctgatt
aacaggctgcttaaggagaactgccccggtgctccaaaacagaaaactttttctgctgtt
tttgaggaaaaaaaatttgacgagagcgagtacgtcaaaatagtcactgattttctaaaa
gttgacgcatattacaccaggcccaatcccgaggatttatgggaggatctcggccatctc
atctattcgaacgacgaaccgttcatgcagcttacgctttactcccagtactgcgttatg
agggatctctcaaagcaggttaaggttgtccttgacgggcaaggtgcagatgagatattc
gccggctatctcgcatatatatactgccatatctcaagcctgttacatggaaaacatttc
ttaacagccgcttcggaatcccttggtgttctgaggcgtcactcgggttttctcttttat
gccgtcaggcagtattttgtccgcaaacagaggcgggatctcataaagggatttgaggag
ccgctggttcgttaccagggaaacctgaacgaatcgctgatgaccgatttaacaagtacg
aaccttccttatctgctacactgggaggacagggtgtcgatggccttctccgtcgaagcg
agagtcccgtttcttgactacagggtcgtgaattttgcaaacagccttcctgcggataaa
aaaatcagaaaaggggttacaaaattcatcttcagaaaatccatcaaagacctggttccc
gaatcgatccggtgcagaatggacaagaaaggcttttccacgcccgaagaagtctggatg
cagggaagccttaaggatcatatcctcgaagtccttgggtccgagtcattttcatcgaga
aagtactgggactccaaaatggtaaccgccgattacaacgactttattgcaggtaaaaag
cagtattcatccgagatctggaggattgtatgcaccgaactctggctaaggatcttcttc
ccctaa

DBGET integrated database retrieval system