KEGG   Methanolacinia petrolearia: Mpet_0506Help
Entry
Mpet_0506         CDS       T01312                                 

Definition
(GenBank) AMP phosphorylase
  KO
K18931  AMP phosphorylase [EC:2.4.2.57]
Organism
mpi  Methanolacinia petrolearia
Brite
Enzymes [BR:mpi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Mpet_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYNP_C Glycos_transf_3 Glycos_trans_3N DUF2254 Molydop_binding Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: ADN35280
UniProt: E1RH56
Position
508652..510190
Genome map
AA seq 512 aa AA seqDB search
MVKLTAKILDIDYRGVLINRIDARKIGVLDGDRVQVINENTGIFVQAFVSTTEKLIEEGS
VGILYLTNKKLNASDGDPFEVRFADRPASIEYIRKKMDGGKLTADETKAIVMDIVDDILS
PGEISAYITGSYIQGLDMDEVEHLTRAMVATGERLNFTSHPIVDKHSIGGVPGNKISLLV
VPIIAAAGLKIPKTSSRAITGAGGTADLMEVLAPVTFSAEEVQKMTEKAGGVIVWGGATN
IAPADDKIIIYEYPFKIDARGQMLASVMAKKYAAGADLVVIDIPVGRNAKVATVEEGRKL
AREFIDLGDRLGMKVECAITYGESPIGHAIGVNLEVREALSILEGSEIPGSLLQKSVSIA
GIALEMSGKAQNGEGPMVARELLKNGKALDKMRQIIEIQGGDPNVKAADISPGENSFNVM
APENGYVVEMNNKALITIARSAGAPNDRGAGIYLHKKKGQRVEKGEPIFTIYADRGWRLD
KAVETARQLMPIIVEGMLIDRVPSGYWRPETE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattaactgcaaaaatactggatattgactaccgcggcgtgctgatcaacagg
attgacgcgagaaagatcggtgttctcgacggcgaccgggtacaggtgataaacgagaat
acgggtatcttcgttcaggccttcgtctcgaccacggaaaagctcatagaggaaggctcg
gtcggaatactttatctaaccaacaagaagctgaacgccagtgacggagatccgttcgag
gtccggtttgcggacagaccggcatccatcgaatatatacggaagaagatggatggcgga
aagctcactgcggacgagacgaaggcaatcgttatggatatcgtggacgatatcctgtcg
ccgggtgagatcagcgcatatatcaccggttcatatatacagggcctcgatatggacgag
gtggagcacctcacaagagcaatggttgcgaccggcgagaggctgaacttcacctcgcac
ccgatcgtcgacaagcactctatcggcggagtcccgggaaataagatctcgctccttgtc
gtccccataatagctgccgccgggctgaagatccccaagaccagctcccgggcgatcacc
ggggcgggagggaccgctgatctcatggaagttctcgcacctgtgactttctccgcagag
gaggttcagaagatgacagaaaaagccggcggcgtaatcgtatggggtggggcgacgaat
atcgcgccggctgacgataagatcataatctacgagtatccgttcaaaatagacgcacgc
ggccagatgcttgcaagtgtgatggcgaaaaaatacgccgcaggcgctgatcttgtggtg
atcgatataccggtagggcggaacgcgaaggtggcgaccgtcgaggaggggagaaagctt
gcacgcgaattcatcgatctcggtgaccgtctcgggatgaaggtagagtgcgcgataact
tatggcgagtcgccgatcggccatgctatcggcgtcaatctcgaggtccgcgaggcgctc
tcgatacttgaaggctccgagatcccgggctcgcttctccagaagagtgtctccatcgcg
ggaatcgccctggagatgtccggtaaggcccagaacggcgaggggccgatggtcgcacgc
gaactcctgaagaatgggaaggctctggacaagatgaggcagataatcgagatccagggc
ggcgatcctaatgttaaggctgcggatatatcacctggcgagaactcgttcaacgtgatg
gcaccggagaacggctatgtcgttgagatgaataacaaggcgcttataacgatcgcaaga
tctgccggagcccctaatgacaggggcgcgggtatctatctccataaaaagaagggccag
cgtgtggagaaaggcgagccgatcttcaccatatatgccgaccgcgggtggcggctggac
aaagcggtagagaccgccaggcagctgatgcctattatcgtcgaagggatgcttatagac
cgtgtcccttcgggttactggagaccggagacagagtga

DBGET integrated database retrieval system