KEGG   Methanoplanus petrolearius: Mpet_0506Help
Entry
Mpet_0506         CDS       T01312                                 

Definition
AMP phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mpi  Methanoplanus petrolearius
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mpet_0506
Enzymes [BR:mpi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mpet_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
508652..510190
Genome map
AA seq 512 aa AA seqDB search
MVKLTAKILDIDYRGVLINRIDARKIGVLDGDRVQVINENTGIFVQAFVSTTEKLIEEGS
VGILYLTNKKLNASDGDPFEVRFADRPASIEYIRKKMDGGKLTADETKAIVMDIVDDILS
PGEISAYITGSYIQGLDMDEVEHLTRAMVATGERLNFTSHPIVDKHSIGGVPGNKISLLV
VPIIAAAGLKIPKTSSRAITGAGGTADLMEVLAPVTFSAEEVQKMTEKAGGVIVWGGATN
IAPADDKIIIYEYPFKIDARGQMLASVMAKKYAAGADLVVIDIPVGRNAKVATVEEGRKL
AREFIDLGDRLGMKVECAITYGESPIGHAIGVNLEVREALSILEGSEIPGSLLQKSVSIA
GIALEMSGKAQNGEGPMVARELLKNGKALDKMRQIIEIQGGDPNVKAADISPGENSFNVM
APENGYVVEMNNKALITIARSAGAPNDRGAGIYLHKKKGQRVEKGEPIFTIYADRGWRLD
KAVETARQLMPIIVEGMLIDRVPSGYWRPETE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattaactgcaaaaatactggatattgactaccgcggcgtgctgatcaacagg
attgacgcgagaaagatcggtgttctcgacggcgaccgggtacaggtgataaacgagaat
acgggtatcttcgttcaggccttcgtctcgaccacggaaaagctcatagaggaaggctcg
gtcggaatactttatctaaccaacaagaagctgaacgccagtgacggagatccgttcgag
gtccggtttgcggacagaccggcatccatcgaatatatacggaagaagatggatggcgga
aagctcactgcggacgagacgaaggcaatcgttatggatatcgtggacgatatcctgtcg
ccgggtgagatcagcgcatatatcaccggttcatatatacagggcctcgatatggacgag
gtggagcacctcacaagagcaatggttgcgaccggcgagaggctgaacttcacctcgcac
ccgatcgtcgacaagcactctatcggcggagtcccgggaaataagatctcgctccttgtc
gtccccataatagctgccgccgggctgaagatccccaagaccagctcccgggcgatcacc
ggggcgggagggaccgctgatctcatggaagttctcgcacctgtgactttctccgcagag
gaggttcagaagatgacagaaaaagccggcggcgtaatcgtatggggtggggcgacgaat
atcgcgccggctgacgataagatcataatctacgagtatccgttcaaaatagacgcacgc
ggccagatgcttgcaagtgtgatggcgaaaaaatacgccgcaggcgctgatcttgtggtg
atcgatataccggtagggcggaacgcgaaggtggcgaccgtcgaggaggggagaaagctt
gcacgcgaattcatcgatctcggtgaccgtctcgggatgaaggtagagtgcgcgataact
tatggcgagtcgccgatcggccatgctatcggcgtcaatctcgaggtccgcgaggcgctc
tcgatacttgaaggctccgagatcccgggctcgcttctccagaagagtgtctccatcgcg
ggaatcgccctggagatgtccggtaaggcccagaacggcgaggggccgatggtcgcacgc
gaactcctgaagaatgggaaggctctggacaagatgaggcagataatcgagatccagggc
ggcgatcctaatgttaaggctgcggatatatcacctggcgagaactcgttcaacgtgatg
gcaccggagaacggctatgtcgttgagatgaataacaaggcgcttataacgatcgcaaga
tctgccggagcccctaatgacaggggcgcgggtatctatctccataaaaagaagggccag
cgtgtggagaaaggcgagccgatcttcaccatatatgccgaccgcgggtggcggctggac
aaagcggtagagaccgccaggcagctgatgcctattatcgtcgaagggatgcttatagac
cgtgtcccttcgggttactggagaccggagacagagtga

DBGET integrated database retrieval system