KEGG   Methanolacinia petrolearia: Mpet_0570Help
Entry
Mpet_0570         CDS       T01312                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mpi  Methanolacinia petrolearia
Pathway
mpi00010  Glycolysis / Gluconeogenesis
mpi00020  Citrate cycle (TCA cycle)
mpi00620  Pyruvate metabolism
mpi00633  Nitrotoluene degradation
mpi00640  Propanoate metabolism
mpi00650  Butanoate metabolism
mpi00680  Methane metabolism
mpi00720  Carbon fixation pathways in prokaryotes
mpi01100  Metabolic pathways
mpi01120  Microbial metabolism in diverse environments
mpi01130  Biosynthesis of antibiotics
mpi01200  Carbon metabolism
Module
mpi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mpi_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_0570
   00020 Citrate cycle (TCA cycle)
    Mpet_0570
   00620 Pyruvate metabolism
    Mpet_0570
   00640 Propanoate metabolism
    Mpet_0570
   00650 Butanoate metabolism
    Mpet_0570
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpet_0570
   00680 Methane metabolism
    Mpet_0570
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mpet_0570
Enzymes [BR:mpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mpet_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADN35344
UniProt: E1RHN5
Position
572243..572770
Genome map
AA seq 175 aa AA seqDB search
MYEIRLHSRGGQGGVTAAKILAHAAFLDGKYATATPLYGAERRGAPVVSFIRIDDKPIKV
YSQVRNPDLVIVLDPGIMNMVDVMQGIHKDGKVLINSPQKPEMGDHKVYNIDLTGIALSL
DLVVAGNPILNTPLLGALAKIGLVSRESVRKAISEAFSDERNGTAALKAYEELVI
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtacgagataaggcttcattcgaggggcggccagggcggtgtgaccgccgcgaagatc
cttgcgcacgccgcattcctcgacggtaaatatgcaaccgcaaccccgctctatggtgcc
gagaggcgcggtgcacccgtggtttcgttcatcaggatcgatgacaagcccataaaggtc
tattcgcaggtaagaaaccccgatcttgtaatagttctcgatccgggcatcatgaacatg
gtcgatgttatgcagggcatccataaggacggcaaagtcctgatcaacagtccccaaaaa
ccggagatgggagatcacaaggtttacaacatcgatcttaccgggatcgctctctctctt
gatctcgtcgtggcaggaaatccgatcctcaacacccctcttctcggggctcttgcaaag
atcggtcttgtctcacgtgagtcggtcaggaaggcgatatccgaggcgttctcggacgag
aggaacgggacagccgcccttaaggcgtacgaggagctggtaatatga

DBGET integrated database retrieval system