KEGG   Methanoplanus petrolearius: Mpet_0664Help
Entry
Mpet_0664         CDS       T01312                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mpi  Methanoplanus petrolearius
Brite
Enzymes [BR:mpi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mpet_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674767..675411
Genome map
AA seq 214 aa AA seqDB search
MKDYESLRSAMVRYQIEGRGISDENVLRVMGEIPRHLFVPENMAGSAYEDCPLPIGYGQT
ISQPYIVAVMTELLELKNDDLVLELGTGSGYQAAVIAGIAKFVRSYERVPELAEYARKNL
ENAGMSNVEVICSDGTDPEPYGDGYDAAIITAASPDIPEYLFPLMKEGGRIVAPVGGYYM
QDLAKVRITGGEPVVTYHGGCRFVPLLGARGWKE
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
ctgaaggattatgaaagccttagatctgcaatggttcgataccagatcgaaggaaggggc
atttcagatgagaatgtcctgagagtcatgggtgagatcccccgccacctgtttgtcccg
gaaaatatggcggggtccgcatatgaagactgtccgcttccaatcgggtacggccagacc
atctcccagccttacattgttgcggtcatgaccgaactcctcgaactgaagaatgacgat
ctggttctcgaactgggcacggggtccgggtaccaggcagctgtaattgcagggatagca
aagttcgtgaggtcttatgaacgtgtccccgaacttgccgaatatgcgagaaaaaacctc
gaaaatgccggaatgtcgaatgttgaagtcatatgcagtgacggtactgacccggaacct
tacggggacggttatgatgctgccatcattaccgctgcatccccggatattcccgaatat
cttttcccccttatgaaagagggaggaaggatcgtggctcctgtaggaggttattatatg
caggatctggcaaaagtccggatcacaggcggagaacctgtcgtgacatatcacggggga
tgcaggtttgttcctctcctgggagcgaggggctggaaggaataa

DBGET integrated database retrieval system