KEGG   Methanolacinia petrolearia: Mpet_0915Help
Entry
Mpet_0915         CDS       T01312                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mpi  Methanolacinia petrolearia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpet_0915
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mpet_0915
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpet_0915
Enzymes [BR:mpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mpet_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(928975..929760)
Genome map
AA seq 261 aa AA seqDB search
MDRIKKAFSKPAFVAYMVAGDPDTERSKIVASALVDGGADIIEVGIPFTDPVADGPVIQA
ADGRALSSGAVPATAFEIAGHIRSISEAAIVIFTYINPIIRMGFDRFYAEAKANGANAVL
IVDMPVEESDEALAAAEKHGLAQIFLVSITTSEERMKKIAGKAKGFAYLISALGTTGQRD
KIPDEALDLIARAKKTFDIPVVVGFGISGPENAKKMIDAGADGVVVGSAIVSAVGENLES
DDGIYESVKGLVGRIRSGIVH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggaccgaataaaaaaggctttctcgaaacctgcgttcgtcgcctacatggtggcgggc
gacccggatacggagagatcgaagatcgtcgcctcggcccttgtcgatggcggtgcggat
atcatcgaggtcggaatcccgttcactgatcctgtggcagacggcccggtgatccaggcg
gcggacgggagggcactctcctcgggagcggttccggcgactgcctttgaaatcgcgggc
catatcaggagcatctcggaggccgcgatcgtgatcttcacgtacataaacccgataatc
agaatgggtttcgacaggttctacgccgaagcgaaggcgaacggtgcgaatgcggtgctc
atcgtcgatatgccggtcgaagagtcggacgaggctcttgcagcggcggagaagcacggg
cttgcacagatctttctggtctcgattacgacgagcgaagagaggatgaagaagatcgca
gggaaggcgaagggctttgcatatctcatctccgctctcggaacgaccggacagagagac
aagatcccggatgaggccctcgatcttatcgcgagggcgaagaagacgttcgacatcccg
gtcgtcgtcggcttcgggatctcggggcccgagaacgcgaagaagatgatcgacgcgggt
gcagacggtgtcgtcgtcgggagtgcgatcgtttcggctgtcggggagaatcttgagagt
gacgatgggatttatgaatcggtgaaagggcttgtgggcaggatcaggtctggcatagtt
cattaa

DBGET integrated database retrieval system