KEGG   Methanoplanus petrolearius: Mpet_1079Help
Entry
Mpet_1079         CDS       T01312                                 

Definition
DNA binding domain-containing protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpi  Methanoplanus petrolearius
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_1079
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_1079
   00620 Pyruvate metabolism
    Mpet_1079
   00640 Propanoate metabolism
    Mpet_1079
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpet_1079
   00680 Methane metabolism
    Mpet_1079
Enzymes [BR:mpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpet_1079
Lipid biosynthesis proteins [BR:mpi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpet_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095454..1097322
Genome map
AA seq 622 aa AA seqDB search
MSTSKAPFYTPQEVADRLRVETRTVHAWLRDGTMKGMKVGRLWRIPESEIDRVRNNIGPA
NGDLGFDIRYKPQNMTDYDYAYKNFRIEVPEKFNFGYDVIDQWADRERNKLAMIWVNTQG
SEKKYSFRDLKNLSNQAANILLKYDINKGDRILIMLPRIPEWWIFVIGIIKLGAVVCPCP
VLLTPKDLKYRINVGKFKMVITDLENAPKINEICKECPSLRSRFVVDGELEGWASYPLEL
LYPAPVSHKSVSMPESFTTYADDPMLIYFTSGTTGEPKMVLHNNAYPLGHRVTAELWHDL
TPNDVHFTYSDTGWAKCAWGKIFGQWIAGACQLIIDVRGHFEATKLLPFIEKYEVTSFCA
PPTVYRMLILADLSKFDLRELRHCTSAGEPLNPEVIKVWKEGTGCTIYEGYGQTETCCAI
SSFPCIRNKPGSMGKPSPGWHIELHDDDGKPVGIHEEGRIAISLNPRPVGLVVEYIDNPE
ANAESFRNGFYYTGDKAYRDEDGYFWFVGRNDDVIKSSGYRIGPFEVESALLEHPAVQES
AVVGSPDRIRGLIVKAFVVLNKGYTPSEDLVRDIQKYVKTVTAPYKYPRAIEFVDELPKT
LSGKIKRNELRDRELKAFRKRE
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgtcaaaggctcctttctacaccccgcaggaggttgcagacaggctcagagtt
gagacgagaacggttcatgcatggctgcgtgacggtacaatgaaaggtatgaaagttggc
cggctttggagaatcccggagagcgagatcgatcgtgtcaggaataacatcggtcctgca
aacggagatctgggttttgatatacgctacaaaccgcagaatatgaccgactacgactat
gcctataaaaatttcaggatcgaagtccccgagaaattcaatttcgggtatgatgtcatc
gaccagtgggccgacagggagagaaacaaactcgcgatgatctgggtgaacacccagggc
agcgagaagaagtactctttccgcgacctgaagaatctctcgaaccaggcggcgaatatt
cttctgaaatacgatatcaacaaaggggatcgcatccttataatgctgccacgtatcccc
gagtggtggatcttcgtcataggtattatcaaactcggtgcggttgtctgcccgtgtcct
gtccttcttacaccaaaggatctcaagtacaggataaatgtaggaaagttcaagatggtc
atcaccgatctcgagaatgctccgaagatcaatgagatctgcaaggagtgtccgtctctc
cgttcgagattcgtagtcgacggcgaactcgagggctgggcgagttatcctctcgaactg
ctttatcctgcaccggtttcacataaatctgtcagcatgcccgagagctttactacatat
gccgacgacccgatgctgatctattttacatccgggactaccggcgaaccaaagatggtt
cttcataataatgcatatcctctcggtcacagggtgaccgccgaactatggcatgacctg
acaccaaatgacgtccactttacgtactccgacaccggctgggcgaaatgtgcctggggc
aagatattcgggcagtggattgcgggcgcctgccagctcatcatcgatgtgagggggcat
ttcgaggccacgaaactgcttcctttcatcgaaaagtacgaggtgacgagcttctgcgca
ccgccgacagtgtacagaatgctcattcttgcagacctgagcaagttcgatcttcgcgaa
ctccgtcactgcaccagtgccggcgaaccgctgaacccggaggtcatcaaggtttggaag
gagggaacgggctgcacaatctatgaaggatacgggcagactgaaacatgctgtgcaatt
tcatctttcccctgcatcaggaacaaaccaggttctatgggcaagccttcgccgggatgg
cacatcgagcttcatgatgacgacgggaaacctgtcggaattcacgaggagggaaggatt
gccatctctctcaacccgaggccggtggggcttgtcgtcgagtacatcgacaaccccgag
gcgaacgcagaatctttccggaacggattttattataccggcgacaaggcgtacagggac
gaggacggttacttctggtttgtcggccgcaacgacgatgtcataaagagttcggggtac
aggattggtccgttcgaggtcgaatcggcgcttctcgaacacccggcagtccaggaatcg
gccgtcgtaggatctcccgacaggatacgcggtcttatcgtcaaggcgtttgtcgtactc
aacaaaggatacacaccgtcggaagatctcgtgagggacatccagaaatacgtcaagaca
gtgacggcaccgtacaagtacccaagagcgatcgaatttgttgatgaactgcccaagact
ctttccggaaagatcaaaaggaacgaactgagggacagggagctcaaggcattcaggaaa
agggaatag

DBGET integrated database retrieval system