KEGG   Methanolacinia petrolearia: Mpet_1080Help
Entry
Mpet_1080         CDS       T01312                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpi  Methanolacinia petrolearia
Pathway
mpi00010  Glycolysis / Gluconeogenesis
mpi00620  Pyruvate metabolism
mpi00640  Propanoate metabolism
mpi00680  Methane metabolism
mpi00720  Carbon fixation pathways in prokaryotes
mpi01100  Metabolic pathways
mpi01110  Biosynthesis of secondary metabolites
mpi01120  Microbial metabolism in diverse environments
mpi01130  Biosynthesis of antibiotics
mpi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_1080
   00620 Pyruvate metabolism
    Mpet_1080
   00640 Propanoate metabolism
    Mpet_1080
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpet_1080
   00680 Methane metabolism
    Mpet_1080
Enzymes [BR:mpi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mpet_1080
Lipid biosynthesis proteins [BR:mpi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mpet_1080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C RHH_1 RHH_3
Motif
Other DBs
NCBI-ProteinID: ADN35847
UniProt: E1RKJ4
Position
1097409..1099253
Genome map
AA seq 614 aa AA seqDB search
MVRFSVTMDDGLVGKIDELSEKKGISRSEWIGRSCLNSADESVLPDGQGLSDLLSLRDRI
PENIPNVTDYDDLYNNFHVTVPDFFNFGFDVIDAWAKIDRNKIAMIWSNLAGDEKIFTFR
DLRNRSNEAANMLLKYGIKKGDLVAIMLHRVPEWWFFAIACIKLGAVFVPCPTMLTTKDL
VYRINAANIKMIVTDMENAPKINQICSQCQSLKSRLVVNGDMEGWVSYLVELDYPAPVSS
KLAVSGLEKTRSSDPMVIYFTSGTTGEAKMVLHNHALPIGHITTGAYWLDLKKNDIHLTI
SDTGWAKSSWGKFFGPWIQGCCSVVYDSRGKFNATEVLPVLEKYGVTTFCCPPTIYRMLI
MADLDKFDLTSLRHCVSAGEPLNPEVIKIWEEGTGLKIYEGYGQTELTLVLGTFPTMKVK
PGSMGKPSPGWHIELHDEDGKPVPTGEVGRIAVKTNPRPVGMFVEYLGSPETTAESFHGG
FYYTGDKAYMDDDGYFWFVGRDDDVIKSSGYRIGPFEVESALIEHPAVQESAVIGTPDPI
RGMIVKAFIVLKGGFEPSEKLVRDIQKHVKTVTAPYKYPREIEFVEELPKTISGKIRRNE
LREKEKKHLREAED
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgcttctccgtaacaatggatgatggtctcgtcggaaaaatcgacgaactgtct
gaaaaaaaagggatctcacgttccgaatggatcggccgctcctgcctgaattcggcggac
gagagcgtccttcccgacggccagggattgtccgatctgctctccctgcgggacaggatt
cctgaaaatattccgaatgtaacagattatgatgatctgtataataatttccatgtcaca
gtcccggacttttttaacttcggtttcgatgtaatcgatgcctgggcgaagatcgacagg
aataagatcgcgatgatatggtccaacctggccggcgacgagaagatattcaccttccgc
gacctgaggaaccgttcgaacgaggcggctaacatgctgctcaaatacgggatcaagaag
ggcgatctggtggcgattatgctccaccgtgttccggaatggtggttctttgcgatcgca
tgcataaaacttggtgcagtttttgtcccgtgcccgacgatgctgacgacgaaggatctg
gtctacaggatcaacgccgcgaacatcaagatgatcgtaaccgacatggagaacgccccg
aagatcaaccagatctgcagccagtgccagtctctcaagtcaaggcttgtcgtcaacgga
gatatggagggctgggtcagttatctcgtcgagctcgattatcctgccccggtctccagc
aaacttgcagtaagcggcctcgaaaagacccgctcctcggacccgatggtcatatacttt
acatccgggacgaccggcgaggcaaagatggttcttcacaaccatgccctgcccataggt
catatcactaccggggcatactggctcgacctgaagaagaacgacattcacctgacgatc
tccgacaccggctgggcgaaatcttcatggggcaagttctttggcccgtggatccaggga
tgctgtagtgtggtgtatgattcccgcgggaagttcaacgcgaccgaggtcctgcctgtt
ctggagaagtacggggtgacgacattctgctgtccgccgacgatataccgtatgctgatc
atggcggacctcgacaagttcgacctgacttctcttcgccactgcgtgagtgccggcgag
ccgctgaacccggaggtcatcaagatctgggaagaaggaacaggccttaagatctacgaa
ggatacggccagaccgaactgactcttgttcttggcacgttcccgacgatgaaggtgaag
ccgggttcgatgggcaaaccctcgcccggctggcatatcgagcttcacgacgaggacgga
aaacctgttccgaccggtgaggtgggaagaattgcggtaaagacgaacccgaggcctgtc
gggatgttcgtagaatatctcgggagcccggagactaccgccgaatccttccacggcgga
ttttattataccggcgataaggcatacatggacgatgacggctacttctggttcgtcggc
cgcgacgacgatgtcataaagagttcgggttacaggatcggtccgttcgaggtcgaatcg
gcacttatcgaacaccccgccgtgcaggagtccgcggttatcggtactcccgatccgata
aggggtatgatcgtaaaggcattcattgtcctcaaaggaggattcgagccgtccgaaaaa
ctcgtccgcgacatccagaagcatgtcaagacagtgaccgcaccatacaagtacccgaga
gagatagaattcgtcgaggaactcccgaaaacgatttccggcaagatccggaggaacgaa
cttcgcgaaaaggagaagaagcatctaagggaagcggaagactaa

DBGET integrated database retrieval system