KEGG   Methanoplanus petrolearius: Mpet_1247Help
Entry
Mpet_1247         CDS       T01312                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mpi  Methanoplanus petrolearius
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mpet_1247
Enzymes [BR:mpi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mpet_1247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1279719..1280573
Genome map
AA seq 284 aa AA seqDB search
MENFFHTIFADASYPYEDSDIIIFGVPYDGTTSYKAGTRDSPDAIRSVSYNFETYLPRID
LDLSGLPVCDLGNLEIDCLPDLVIDQVERTVREIAGDGKFPLMIGGEHSVTVGAVRALSP
ECYIVCDAHLDLREEFGGSIYNHACVAKRVLDLGVGEVFIIGTRSGTFEEYGLVRSDSRI
STYSPEDIAARGLDAVLDEIQEKTSGKRTYLSIDADAIDCCLTPGLGTPEPFGLRPEDIR
AVVDRFGTVCCGFDYVEVCPIDNGQTAAVAAKIIRELIGLKNKK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttttttcatacgatttttgccgatgcttcatatccctatgaggattcggat
ataattattttcggagttccgtatgacggaaccacttcgtataaggccgggacgcgtgat
tctcccgatgcaataagaagcgtatcatataattttgaaacatatctcccgcggattgat
ctggatctgtcaggtcttcctgtatgtgatctcggcaatcttgagattgattgtcttccc
gaccttgtcatagatcaggtcgaaagaacagtgcgcgagattgccggagacggtaaattt
ccgctgatgatcggcggagaacattcagttactgtaggggcagtgcgtgcattgtctcct
gaatgctacattgtctgcgatgcccacttggatttgagggaggagttcgggggcagcata
tacaaccatgcatgtgttgcaaagcgcgtacttgatctcggcgtaggagaggtattcatc
ataggtacgagaagcgggacctttgaagaatacggccttgtgagaagcgattcgcgaatc
agtacctattctcctgaggatattgctgccagaggccttgatgctgttctggatgagata
caggagaaaacttcaggaaagagaacatatctctcgatagatgcagatgcgatcgactgc
tgtctcacccccggcctgggaacccccgagccgttcgggcttcggcctgaggatatcagg
gctgttgtagatcgtttcggaaccgtatgctgcggatttgattatgtggaagtctgcccg
atcgacaacggccagactgcagcagttgcagccaagattatccgcgagcttattggactt
aaaaataaaaaataa

DBGET integrated database retrieval system