KEGG   Methanolacinia petrolearia: Mpet_1327Help
Entry
Mpet_1327         CDS       T01312                                 

Definition
(GenBank) Cellulase
Organism
mpi  Methanolacinia petrolearia
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1354646..1355686)
Genome map
AA seq 346 aa AA seqDB search
MVKELLGKLSDAHGLSASEGNVRAIIREELDGFVDEIYEDKMGNLVAVKKGDDFRIMIAS
HMDEIGFMVQYIDEKGFIKFVPIGGWYNPVAYTQRVILHGKKGQVTGVIGAKPPHVMTPE
DRKKEIKTDDMFIDVGATSEKEVNELGIEIGTSITIDREYKLLANNRLTGKALDNRVGVA
MLIETLKQAKSPHTIYGVFTVQEEVGLKGAKVSAFALKPDCAIATDVTISGDHPGITKKE
ASVEMGKGPVLALVSAAGRGIMSDPKVTEWLRKTAESNKIPLQLEVGDGGNTDATIIHLV
RDGIPSIPFQIATRYIHSPIEVVDLTDVEEGIKLLVAALKTKPAFN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaattacttggaaaactttcagacgctcacggcctctcggcaagcgaggga
aatgtcagggcaataatcagggaggagctcgacggctttgtcgatgagatctacgaggac
aagatgggcaatctggttgcggtcaaaaaaggcgacgatttcaggatcatgatcgcatcg
cacatggacgagatcggcttcatggtccagtatatcgacgagaaaggctttatcaaattc
gtccccatcggcggctggtacaatcccgtcgcatatacccagagggtcattcttcacggt
aagaaagggcaggtcaccggtgttatcggtgcaaagccgccccatgtgatgactcccgag
gacaggaagaaagagattaagaccgatgatatgttcatagacgttggtgcaacgagcgag
aaggaagtaaacgaactcgggatcgagatcggaacgtcgatcaccatcgacagggaatac
aaacttcttgcaaacaacaggctcaccggaaaggcgctcgacaacagggtcggcgtcgca
atgctcatagagaccctgaagcaggccaaatcaccgcatacgatatacggcgtctttaca
gtccaggaagaagtcggcctgaagggagcgaaggtcagcgcattcgccctcaaacccgac
tgtgcaatcgcgaccgacgtaaccatctcgggcgatcaccccgggatcacgaagaaggaa
gcctccgtagagatgggaaaagggccggtgcttgcactggtaagtgcagcaggacgtggc
attatgtccgatcccaaagttaccgaatggctgaggaagaccgcagaatcgaataagatc
cctctccagctggaagtcggagacggcggaaatacggatgcaacgatcatccatcttgta
agagacggtattcccagcattccattccagatcgcgacaaggtatatccactctccaatc
gaggttgtggacctgactgatgtagaagaaggcataaagctgctggttgcagcactgaaa
acaaagcctgccttcaactga

DBGET integrated database retrieval system