KEGG   Methanoplanus petrolearius: Mpet_1339Help
Entry
Mpet_1339         CDS       T01312                                 

Definition
deoxyribose-phosphate aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mpi  Methanoplanus petrolearius
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpet_1339
   01230 Biosynthesis of amino acids
    Mpet_1339
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpet_1339
   00030 Pentose phosphate pathway
    Mpet_1339
   00051 Fructose and mannose metabolism
    Mpet_1339
  Energy metabolism
   00680 Methane metabolism
    Mpet_1339
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpet_1339
Enzymes [BR:mpi01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mpet_1339
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mpet_1339
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1365507..1366424)
Genome map
AA seq 305 aa AA seqDB search
MSFTYEIEVPADVPVSAKGTYVENMKMITHGSGNLMLFAGDQKVEHLNDDFFGKDIATDD
ASPEHLFRIAKEGRIGVFATQLGLIAKYGKDYREIPYLVKLNSKTHLVKTDQKDPLSPQL
YSIDQIVRFRDQTGLAITGVGYTIYLGSEYEGEMIREAAQIIYEAHQHGLIVVLWIYPRG
KAVKDEKDPHLIAGAAGVASALGADFVKVNAPKKDGSSSAELMKEAVAAAGKTKLVCAGG
SSVSGEDFLKQLYDQIHTGGASGNATGRNIHQKTLDEAVRMCNAVSAITIDNAEIAAALK
IYNNQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttacatacgagatcgaagttccggccgacgttcccgtgagcgcgaaagggacg
tatgtcgagaacatgaagatgataacccacggaagcgggaatctcatgctcttcgcaggc
gaccagaaggtcgagcacctcaacgacgatttcttcggcaaggatatcgcaacagacgat
gcatcacccgagcatctgttcaggatcgcaaaagaaggaaggatcggtgttttcgcaacc
cagctcggccttattgcaaaatacggtaaggactacagggagatcccctaccttgtaaag
ctcaattccaagactcatcttgtaaagacggaccagaaggatcccctcagcccgcagctc
tattcgatcgaccagatcgtcaggttccgcgaccagaccggcctggcaattacaggggtg
ggatatacgatctatctcggtagcgaatacgagggagagatgatccgcgaagcagcacag
atcatctacgaggctcaccagcacggtctcatagtcgttctttggatctacccgcgtgga
aaagccgtaaaggacgagaaggacccgcacctgatcgccggcgcagcaggagtcgcatcg
gccctcggtgccgatttcgtcaaggtcaatgccccgaagaaggacggaagttcgtcagcg
gaacttatgaaagaagccgtcgcggcagcaggaaaaacgaaactggtctgtgcaggcggt
tcgagtgtctcgggcgaggatttcctcaaacagctctacgaccagatacacaccggcggc
gcatcggggaatgcgaccggaaggaacatccaccagaaaactctcgacgaagcggtaagg
atgtgcaacgcagtgtcggcaataacaatcgacaatgcagagatcgcggctgcattaaag
atctacaacaatcaataa

DBGET integrated database retrieval system