KEGG   Methanoplanus petrolearius: Mpet_1693Help
Entry
Mpet_1693         CDS       T01312                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mpi  Methanoplanus petrolearius
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mpi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1729783..1730331)
Genome map
AA seq 182 aa AA seqDB search
MQNKEFELTGRRLFNEGLVAGNFGNMSVRVRGGFLITSSGSFLDEEESLKFVTMDGVPED
GASSEWRVHYRAYLACDDAEAIVHAHPPLSVAASLVYDEIIPEDSEGKMLCPVIPVVDGE
PGTDELAENVAKALVSNPVVVAKGHGTFAKGKDLKEAYLLTSTAEHCCKILYYLGGFGGR
SF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcagaataaagaatttgaactgactggcaggcgcctttttaatgagggccttgttgcg
ggcaatttcgggaatatgagtgtccgggtccggggcgggtttcttataacttccagcggg
tcgttccttgatgaagaagaaagcctgaagttcgttacgatggacggggttcccgaagat
ggtgcttcaagcgagtggagggtccactacagggcatacctggcctgtgatgatgcggag
gcgatcgttcatgcccaccctccgctctccgtagccgcatcgcttgtatacgatgaaata
attccggaggacagtgaagggaagatgctctgtccggttatacctgtggtcgacggtgaa
cccggaacagatgagctggcggagaatgttgcgaaagctctggtctcgaatcccgtagtc
gttgcaaagggccacgggacgtttgcaaaaggcaaagacctgaaggaggcctaccttctt
acatcgactgcagaacactgctgcaaaatattatattatctcggagggttcggaggacgg
agcttctga

DBGET integrated database retrieval system